PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma15g00510.1
Common NameZOSMA_15G00510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family LBD
Protein Properties Length: 210aa    MW: 22747.6 Da    PI: 7.4316
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma15g00510.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.6e-4330128199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC ++C++apyfp ++p+kfanvhk+FGasn++kll++l + +reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++el
  Zosma15g00510.1  30 PCAACKLLRRKCIPGCIFAPYFPPDDPQKFANVHKIFGASNITKLLNDLLPYQREDAVNSLAYEAEARMKDPVYGCVGAISVLQKQVQRLQNEL 123
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++++
  Zosma15g00510.1 124 DAANT 128
                      99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.95529130IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4230127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MAQAKNNNSC TRKNIMASSQ SNSSTNSTPP CAACKLLRRK CIPGCIFAPY FPPDDPQKFA  60
NVHKIFGASN ITKLLNDLLP YQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQKQVQRLQ  120
NELDAANTNL LRYACNIVDI PSSMDRLPLM GSTSSTGLGE GSVGGGDLYH HHHASGLPIP  180
YTQAWGNNNR SNYHPPGDMD EMDGGERSM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795982.17e-80PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 25-like
SwissprotQ9FML44e-63LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0K9PUJ91e-157A0A0K9PUJ9_Z
STRINGPOPTR_0015s09370.13e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-62LBD family protein