PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma149g00280.1
Common NameZOSMA_149G00280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 265aa    MW: 30460.5 Da    PI: 6.9944
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma149g00280.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.2e-55191441128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL kk+ + ++ + ++i +vd++k+ePwdLp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke++
  Zosma149g00280.1  19 LPPGFRFHPTDEELVTYYLSKKIIDGNFVC-RAIGDVDLNKFEPWDLPWRAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIY 110
                       79*************************999.89***************888999*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + ++ lvg+kktLvfy+grapkg kt+Wvmheyr 
  Zosma149g00280.1 111 R-SNILVGMKKTLVFYTGRAPKGGKTNWVMHEYRS 144
                       *.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6412169IPR003441NAC domain
PROSITE profilePS5100558.48619169IPR003441NAC domain
PfamPF023651.7E-2920143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MECPIPMTQQ EVEEDVVELP PGFRFHPTDE ELVTYYLSKK IIDGNFVCRA IGDVDLNKFE  60
PWDLPWRAKM GEKEWYFFCV RDRKYPTGLR TNRATEAGYW KATGKDKEIY RSNILVGMKK  120
TLVFYTGRAP KGGKTNWVMH EYRSHPHSYL HIISKTDKNE WVICRVFQKS LVLDRRINAN  180
EMDRPFPPSM DTNFVGVETA MVSHATHHVS CFSNVMDGCL NTQFFTAPNN YYVDTTAFFD  240
MSGHSGGGYS LDSALRGDSF VWNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-55617011166NO APICAL MERISTEM PROTEIN
1ut4_B8e-55617011166NO APICAL MERISTEM PROTEIN
1ut7_A8e-55617011166NO APICAL MERISTEM PROTEIN
1ut7_B8e-55617011166NO APICAL MERISTEM PROTEIN
3swm_A8e-55617014169NAC domain-containing protein 19
3swm_B8e-55617014169NAC domain-containing protein 19
3swm_C8e-55617014169NAC domain-containing protein 19
3swm_D8e-55617014169NAC domain-containing protein 19
3swp_A8e-55617014169NAC domain-containing protein 19
3swp_B8e-55617014169NAC domain-containing protein 19
3swp_C8e-55617014169NAC domain-containing protein 19
3swp_D8e-55617014169NAC domain-containing protein 19
4dul_A8e-55617011166NAC domain-containing protein 19
4dul_B8e-55617011166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783580.11e-95NAC domain-containing protein 92-like
RefseqXP_008783588.11e-95NAC domain-containing protein 92-like
RefseqXP_028056118.11e-95NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-90NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0K9PWN00.0A0A0K9PWN0_ZOSMR; NAC domain-containing protein 2
STRINGXP_008783580.15e-95(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.15e-93NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]