PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma149g00200.1
Common NameZOSMA_149G00200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 431aa    MW: 48501.6 Da    PI: 8.4606
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma149g00200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.41e-51161422128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                        pGfrFhPtdeelv +yLk+kv +k+l++ e i++++iyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s
  Zosma149g00200.1  16 LPGFRFHPTDEELVGFYLKRKVLQKPLSI-ELIRQLNIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYS 107
                       69***************************.89***************8888999*************************************** PP

               NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  Zosma149g00200.1 108 SeGNKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 142
                       956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5614175IPR003441NAC domain
PROSITE profilePS5100556.14615175IPR003441NAC domain
PfamPF023652.2E-2517142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MMEERNDLEK IDEVILPGFR FHPTDEELVG FYLKRKVLQK PLSIELIRQL NIYKYDPWDL  60
PKLATTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG NKCIGLKKSL  120
VFYKGRAAKG IKTDWMMHEF RLPSITDPTL LPKRPIDHRN ITANDLWAIC RIFKKTNSMA  180
HRALSQSWAS PILQTTTHDH SSNIFSLSST TTDVRSTINF TGNTGAVTPA DYPPVTTAQM  240
EPNPYKPIDI PTSCFMYSTD DTSKTMLMNL PSTLFTEDAQ KVVSTANATG SIDFAHHDHR  300
YKKSDFQHPT VLQPCSNNSF SIDQLSHVQD MMNGDLRSVG REMCMTRNNN GQCYINQWSN  360
IRQSSTCTST STGTAATNTA GTGLNSPTIF PASVVSDAWR SNLHPQHWDS PPCPTSEMSA  420
SYSSKFSALD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-531717819168NO APICAL MERISTEM PROTEIN
1ut4_B5e-531717819168NO APICAL MERISTEM PROTEIN
1ut7_A5e-531717819168NO APICAL MERISTEM PROTEIN
1ut7_B5e-531717819168NO APICAL MERISTEM PROTEIN
3swm_A5e-531717822171NAC domain-containing protein 19
3swm_B5e-531717822171NAC domain-containing protein 19
3swm_C5e-531717822171NAC domain-containing protein 19
3swm_D5e-531717822171NAC domain-containing protein 19
3swp_A5e-531717822171NAC domain-containing protein 19
3swp_B5e-531717822171NAC domain-containing protein 19
3swp_C5e-531717822171NAC domain-containing protein 19
3swp_D5e-531717822171NAC domain-containing protein 19
4dul_A5e-531717819168NAC domain-containing protein 19
4dul_B5e-531717819168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937354.11e-135putative NAC domain-containing protein 94
TrEMBLA0A0K9PWX60.0A0A0K9PWX6_ZOSMR; NAC domain protein
STRINGXP_008784123.11e-128(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-102NAC family protein