PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1406g00020.1
Common NameZOSMA_1406G00020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41581.1 Da    PI: 8.6536
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1406g00020.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.74.9e-21952144
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                       kr en s r+vtfskR++gi+KKA+ELS+LCd++ a+++fs+  
  Zosma1406g00020.1  9 KRLENASGRHVTFSKRKTGIIKKAKELSILCDIDLALLMFSPAE 52
                       689**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.92E-23181IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.969153IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-28160IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRAKLKIKR LENASGRHVT FSKRKTGIIK KAKELSILCD IDLALLMFSP AEKAILCLGE  60
NSTIDQVLHK FSQQTPQERA KRLYFYPILI IEFLIYQTMM KVLKKTFKKL DHDVNIQDFV  120
GSRDTSRYNI DPANMEGSSS NLFQGGMQSM HIEAQPPMPW IQNNAQHTML LPNVTIHNFP  180
LAAQKDTHVP RPMQNNTPRP MQNNTPLDHK DTSRYNIDPA NMEGSSSNLF QGGMQSMHMA  240
AQPPMPSIQN NAQHTMLLRN VTNHNFPLAA QNDTHVPHPM QNNTPRPMQN NTPLDHKDTS  300
RYNIDPVNFS DFFEINTQDY QLDGSSQDET AVMNLNEMDR HHRSMNMQQQ LGGSQHSYQP  360
SSSST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PXZ80.0A0A0K9PXZ8_ZOSMR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.28e-42AGAMOUS-like 30