PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma13g00660.1
Common NameZOSMA_13G00660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family bZIP
Protein Properties Length: 334aa    MW: 36401.3 Da    PI: 8.0509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma13g00660.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_161.81.3e-19191244356
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      + kr +r+++NRe+ArrsR+RK+a + eLe+ v +L++eN++L+++l+ l+k++
  Zosma13g00660.1 191 DAKRVKRMISNRESARRSRRRKQAHLSELETQVSQLKGENSSLIEKLSDLSKKY 244
                      689***********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000416.0E-5188204IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.5E-20189253IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-15190244No hitNo description
PROSITE profilePS5021711.863191243IPR004827Basic-leucine zipper domain
PfamPF001706.5E-18192244IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.94E-13193244No hitNo description
PROSITE patternPS000360196211IPR004827Basic-leucine zipper domain
PRINTSPR000416.0E-5206226IPR001630cAMP response element binding (CREB) protein
PRINTSPR000416.0E-5226243IPR001630cAMP response element binding (CREB) protein
PfamPF124982.6E-6260278IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVRRDSEWVF EKFLRETTNG SSSPAILEGG GEEEESDVVE MMMDDCNVRK KSRRIVVEGD  60
SHSLPGKSCV PDPEFLKKQL DLACAAAAVA FCRKNVQELS PPLPSAEVVT ITGSEMASQA  120
PVNGSAFGVQ KMLKNDIHGN VGSSRSALSK AQNSVGQPQT KPLTSSSLRE QTDEDELLSG  180
VETVENLDPA DAKRVKRMIS NRESARRSRR RKQAHLSELE TQVSQLKGEN SSLIEKLSDL  240
SKKYHGACVN SRILKADVET MRAKVKMAED MVKRVTGVAV GASPRWVGGI TKLWNNAMNE  300
SVEVSKKCVE VESPPLNGID ASNWNNIKCS ISK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205212RRSRRRKQ
2207212SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9Q0330.0A0A0K9Q033_ZOSMR; Basic-leucine zipper (BZIP) transcription factor family
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.27e-28bZIP family protein