PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma136g00360.1
Common NameZOSMA_136G00360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family M-type_MADS
Protein Properties Length: 350aa    MW: 40026.1 Da    PI: 6.707
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma136g00360.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.98.6e-21953145
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      kr en   rqvtfskRr+gi KKA ELS+LCd+e a+++fs+ gk
  Zosma136g00360.1  9 KRLENLGGRQVTFSKRRAGIVKKATELSILCDIELALLMFSPAGK 53
                      67889999**********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.558153IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-23295IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-18323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-181554IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRVKLKIKR LENLGGRQVT FSKRRAGIVK KATELSILCD IELALLMFSP AGKATLCLGE  60
KSTIDQVLLK FSQQTPQERA KRKLESLEVL KKTFKKLDHD VNIKDFVGSS SKNPIEDMGN  120
HMRMLQGQLL ELQNRLSFWV EPESVDKLEH ITEMEDYLRH ALNDLDAQKE MCDRINFANM  180
EGSSSNQFQG GTQSIHMATQ PLMPQIQNNA QHTMFNAQHT MQLPNVTDHN IPLTAQNDDT  240
SRYNIDPKIF SDFFGMNNQD RQFDSNRQAE TTVMNLNEMG HHQRSMNMQQ QLGGGQHSYQ  300
PSSSFNMTTQ QVEKNIKNDL DLNYNHLGED QISGYNVRQI DPHYDYGFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-15192190MEF2 CHIMERA
6byy_B4e-15192190MEF2 CHIMERA
6byy_C4e-15192190MEF2 CHIMERA
6byy_D4e-15192190MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008802579.15e-78agamous-like MADS-box protein AGL65 isoform X1
TrEMBLA0A0K9PYD00.0A0A0K9PYD0_ZOSMR; MADS-box transcription factor
STRINGXP_008802579.12e-77(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.29e-69AGAMOUS-like 30