PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma120g00460.1
Common NameZOSMA_120G00460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 291aa    MW: 33236.7 Da    PI: 6.0869
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma120g00460.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.6e-54131431129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv++yL+kkv++k+++l  +ik++d+yk+ePwdL++  ++  ee+ ewy Fs++dkky+tg+r+nrat++g+Wkatg+dk
  Zosma120g00460.1  13 VPPGFRFHPTDEELVDYYLRKKVASKEIDL-GIIKDIDLYKMEPWDLQEqcRIGVEERdEWYLFSHKDKKYPTGNRTNRATAAGFWKATGRDK 104
                       69****************************.99**************953444444446********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       ++++k++ +vg++ktLvfy grap+g+k+dW+mheyrle
  Zosma120g00460.1 105 PIYTKRNLVVGMRKTLVFYMGRAPTGQKSDWIMHEYRLE 143
                       *************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-589163IPR003441NAC domain
PROSITE profilePS5100558.16213163IPR003441NAC domain
PfamPF023654.6E-2814142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEIKENMDDL PYVPPGFRFH PTDEELVDYY LRKKVASKEI DLGIIKDIDL YKMEPWDLQE  60
QCRIGVEERD EWYLFSHKDK KYPTGNRTNR ATAAGFWKAT GRDKPIYTKR NLVVGMRKTL  120
VFYMGRAPTG QKSDWIMHEY RLETVQNGPP QEEGWVVCRV FKKRATAVEI AAASIPRPTG  180
SFSSSFWYDD QVSFMPELDM ELLHHNQSIF PLHQLEMSSP KINPIPDWEL LDKLVASQLG  240
HGDHHDGNII IPNELNHCSS SIDASGEKLA AGLTVADEHA ASTSSCHMWK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-501316717169NO APICAL MERISTEM PROTEIN
1ut4_B7e-501316717169NO APICAL MERISTEM PROTEIN
1ut7_A7e-501316717169NO APICAL MERISTEM PROTEIN
1ut7_B7e-501316717169NO APICAL MERISTEM PROTEIN
4dul_A7e-501316717169NAC domain-containing protein 19
4dul_B7e-501316717169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006878587.11e-110NAC domain-containing protein 7
SwissprotQ9FWX28e-98NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0K9Q0W90.0A0A0K9Q0W9_ZOSMR; NAC domain protein
STRINGERM947321e-109(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-100NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]