PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma103g00580.1
Common NameZOSMA_103G00580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NAC
Protein Properties Length: 525aa    MW: 59537.6 Da    PI: 6.5088
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma103g00580.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.31.2e-5661331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeelv++yLk+k++g+++el e+i+evd+yk+ePwdLp+   + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatgkd++
  Zosma103g00580.1   6 LPPGFRFHPTDEELVSYYLKRKLNGRQIEL-EIIPEVDLYKCEPWDLPEksYLPSKDLEWYFFSPRDRKYPNGTRTNRATQAGYWKATGKDRK 97 
                       79****************************.99***************5234555777*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v s ++++vg+kktLv+++grap+g++tdWvmheyrl
  Zosma103g00580.1  98 VSS-QKREVGMKKTLVYHRGRAPHGSRTDWVMHEYRL 133
                       **9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-644156IPR003441NAC domain
PROSITE profilePS5100561.2236156IPR003441NAC domain
PfamPF023651.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV SYYLKRKLNG RQIELEIIPE VDLYKCEPWD LPEKSYLPSK  60
DLEWYFFSPR DRKYPNGTRT NRATQAGYWK ATGKDRKVSS QKREVGMKKT LVYHRGRAPH  120
GSRTDWVMHE YRLDERECES SSGLQDAYAL CRVFKKSAPG PKIIEHYGAT CHHQPNINNN  180
KNNSWAPELS FDQHGFEMSS SRDPYHFVHG STSASSHHVD PFGSSREGTG CGSSWMQYLN  240
TTDDHTTAFS STNNIPSLIM DQQPPTTFDF VPSKVDIALE CARLQHRFSL PPLEVEDFPQ  300
FDTVNFLQSG EKNQLDALQE ILSVASASAS GYEDVWAELG VGTTTINTSI PSTDSYPPEQ  360
MQERLIQIDE FEVGDKLTSS GDPGNDCQNF PTSALINIVE ESEEKEDDEN IGFINFSQGS  420
FIATHNISET FFHYVQPSTK ISVHVHPIEP QTVKMNENRR SGTGRKWGMK VKNMVMRCRS  480
WVTDVKKKHF STLFFNKRCS LLTVAVALCA SGFHYRLISF ISSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B6e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A6e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_B6e-56116212171NO APICAL MERISTEM PROTEIN
3swm_A7e-56116215174NAC domain-containing protein 19
3swm_B7e-56116215174NAC domain-containing protein 19
3swm_C7e-56116215174NAC domain-containing protein 19
3swm_D7e-56116215174NAC domain-containing protein 19
3swp_A7e-56116215174NAC domain-containing protein 19
3swp_B7e-56116215174NAC domain-containing protein 19
3swp_C7e-56116215174NAC domain-containing protein 19
3swp_D7e-56116215174NAC domain-containing protein 19
4dul_A6e-56116212171NAC domain-containing protein 19
4dul_B6e-56116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649289.11e-150PREDICTED: NAC domain-containing protein 86-like
TrEMBLA0A0K9Q6960.0A0A0K9Q696_ZOSMR; Uncharacterized protein
STRINGOB03G11530.11e-149(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-110NAC domain containing protein 28