PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM5G868355_P01
Common NameZEAMMB73_132857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 381aa    MW: 42723.6 Da    PI: 6.5888
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM5G868355_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS256.59.6e-79953802287
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         + L++cA+a+++gd + a+++L+++++++s +gd++qRla +f+e+L+ rla+++s++y++l +++ts   ++e l+a+klf  +  + k+
  GRMZM5G868355_P01  95 HTMLIHCAQAMATGDRRSATEMLKQIKQHSSLRGDATQRLAYCFAEGLEVRLAGTGSQVYQSLMAKRTS---VVEFLKAYKLFLAAISLNKV 183
                        578************************************************************999999...******************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                          +  N  I++av+g +++Hi+ +++++GlQWp Ll+ La R++gpp++R Tg++ p++g   + ++eetg+rL++ A+e+gvpf+f++ +a
  GRMZM5G868355_P01 184 HIIFSNGNIVDAVAGRSKLHIVAYGVQYGLQWPGLLHFLAGREGGPPEVRFTGIDLPQPGfrPAYQIEETGRRLSNCAREFGVPFKFHA-IA 274
                        ***********************************************************99999*************************.79 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         ++e+++ e+L+++p+E+l+Vn+  +l +l+de v+ +   +rd vL+ +++++P++++ + +   ++++ Fl+rf eal yysalfd+l+a
  GRMZM5G868355_P01 275 AKWEMVSAEDLNIDPDEVLVVNSDCHLSNLMDEGVDADTpsPRDLVLNNIRKMRPNIFIQIVNSGTYGAPFFLTRFREALFYYSALFDMLDA 366
                        9*******************************9887665559************************************************** PP

               GRAS 274 klpreseerikvEr 287
                        ++pr+++er  +Er
  GRMZM5G868355_P01 367 TIPRDNDERLLIER 380
                        ************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.77468381IPR005202Transcription factor GRAS
PfamPF035143.3E-7695380IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MFGGSSNGRG RKNSHTQEDL ESEMGRNSKL MMPEQEETGA SELFDELMSC KYDGFLKHMQ  60
DLRIAMDSES EKSVRRVSGK GARGKQHGNE FVDLHTMLIH CAQAMATGDR RSATEMLKQI  120
KQHSSLRGDA TQRLAYCFAE GLEVRLAGTG SQVYQSLMAK RTSVVEFLKA YKLFLAAISL  180
NKVHIIFSNG NIVDAVAGRS KLHIVAYGVQ YGLQWPGLLH FLAGREGGPP EVRFTGIDLP  240
QPGFRPAYQI EETGRRLSNC AREFGVPFKF HAIAAKWEMV SAEDLNIDPD EVLVVNSDCH  300
LSNLMDEGVD ADTPSPRDLV LNNIRKMRPN IFIQIVNSGT YGAPFFLTRF REALFYYSAL  360
FDMLDATIPR DNDERLLIER D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-34983808285GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1237720.0ovary| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM5G868355
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM5G868355_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9760950.0EU976095.1 Zea mays clone 622740 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK7UNM50.0K7UNM5_MAIZE; Uncharacterized protein (Fragment)
STRINGGRMZM5G868355_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-103SCARECROW-like 14