PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM5G858197_P02
Common NameZm.81747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 260aa    MW: 27553 Da    PI: 9.5938
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM5G858197_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.29.9e-15178227352
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                        + +r++r++kNRe+A rsR+RK+a+i+eLe  v  Le+eN +L  e ee 
  GRMZM5G858197_P02 178 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTHLEEENAELLREQEER 227
                        689*************************************9987766543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-8176238IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.634178226IPR004827Basic-leucine zipper domain
PfamPF001701.1E-13178235IPR004827Basic-leucine zipper domain
CDDcd147072.09E-19180230No hitNo description
SuperFamilySSF579593.63E-11181228No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-13181236No hitNo description
PROSITE patternPS000360183198IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MASSRVMPSS SPSHTASDLA RLAQAASRPG GGGSGLGSMN VEELLRGIYS DMPTPAPPAS  60
EPERPRSPAP APEVATRRTA EEVWKEITGG GGSGEPVPPV AAQAAVPAGG GGAGGPEMTL  120
EDFLAREEGA VKEDGVRVSG PSAPAMGFLG GAEGVGVPGG GGGRGRKRQL MDPVDRAAMQ  180
RQKRMIKNRE SAARSRERKQ AYIAELESLV THLEEENAEL LREQEERHQK RLKELLERVT  240
PVILRKKPSG DLRRTNSMQW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.817470.0ear| embryo| endosperm| meristem| ovary| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM5G858197
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM5G858197_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0541490.0BT054149.1 Zea mays full-length cDNA clone ZM_BFb0134E03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001354068.10.0uncharacterized protein LOC100280716
SwissprotQ0JHF19e-94BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A3L6FM560.0A0A3L6FM56_MAIZE; G-box-binding factor 4
TrEMBLB7ZXV70.0B7ZXV7_MAIZE; BZIP transcription factor
STRINGGRMZM5G858197_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Representative plantOGRP9845410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.17e-19bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]