PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM5G830671_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 242aa    MW: 26213.3 Da    PI: 9.6311
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM5G830671_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.54e-17103157256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++t+eq + Le+ F+ ++ +s++++ e A++++L+ rqV vWFqNrRa+ k
  GRMZM5G830671_P01 103 RKKLRLTTEQSKLLEDTFRAHNILSHAQKHEVARQVDLSARQVEVWFQNRRARTK 157
                        788899***********************************************98 PP

2HD-ZIP_I/II1025e-33103190188
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                        +kk+rl++eq+klLE++F++++ L++ +K+e+ar+++l++rqv+vWFqnrRARtk+kq+E+d+e+L+r+ ++l++en rL+ e e+L+
  GRMZM5G830671_P01 103 RKKLRLTTEQSKLLEDTFRAHNILSHAQKHEVARQVDLSARQVEVWFQNRRARTKLKQTEVDCETLRRWRESLADENLRLRLELEQLQ 190
                        69***********************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-1883157IPR009057Homeodomain-like
SuperFamilySSF466897.1E-1886160IPR009057Homeodomain-like
PROSITE profilePS5007116.76399159IPR001356Homeobox domain
SMARTSM003893.3E-12101163IPR001356Homeobox domain
PfamPF000462.3E-14103157IPR001356Homeobox domain
CDDcd000862.99E-13103160No hitNo description
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
SMARTSM003409.5E-11159202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MYTTTRAMEK EEGFGKSWLG LGIGGGGRDL NLMKRSRPLR PVRLDLLFPP SVEGGEAAAR  60
SRKAGAGALR NMSLKQVAGD DDGGQSSHGG PSPSDDDDGA GARKKLRLTT EQSKLLEDTF  120
RAHNILSHAQ KHEVARQVDL SARQVEVWFQ NRRARTKLKQ TEVDCETLRR WRESLADENL  180
RLRLELEQLQ RWATAAAGQS SASPSPATAT ASVCPSCDKV VVVTVTSCGE TSGKSSTSSY  240
SS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151159RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM5G830671
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM5G830671_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554314e-54EU955431.1 Zea mays clone 1531862 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008648902.11e-177homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F67e-44HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A1D6LP041e-175A0A1D6LP04_MAIZE; Putative homeobox DNA-binding and leucine zipper domain family protein
STRINGGRMZM5G830671_P011e-177(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.17e-29HD-ZIP family protein