PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G589696_P01
Common NameLOC100193142, ZEAMMB73_213048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 297aa    MW: 31442.7 Da    PI: 8.2743
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G589696_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77.2e-4062122262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  GRMZM2G589696_P01  62 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 122
                        7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3160120IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3363120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22766120IPR003851Zinc finger, Dof-type
PROSITE patternPS01361068104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MMAGAPPTMH ICMDSDWLKG IVVPEEPGMG GSSSSPSAEL IACPRPPMHA AAADHRRLRP  60
QHDQPLKCPR CESTHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGSLRNVP VGGGCRKNKR  120
ASAKKHPAAT PMQPRHVAET GLHLSFSGVQ LPPPPSPAAA ADPLCSLGLL DWKYDPILAG  180
SGGAAAGSLD GASSEAHFAG AGMLGIPGGG ECYALSSLRY AADLGEHLQL QGLPFGLRAE  240
QESMEVKAAA TERTLSLDWY SETSRAPESA LSSLGALGLW SGMLRGAHQH HGSSAAI
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G589696
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G589696_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353260.0BT035326.1 Zea mays full-length cDNA clone ZM_BFb0055G17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001131772.10.0Dof zinc finger protein DOF2.1
TrEMBLA0A3L6EX910.0A0A3L6EX91_MAIZE; Dof zinc finger protein DOF5.6
TrEMBLB4FDY80.0B4FDY8_MAIZE; Dof zinc finger protein DOF2.1
STRINGGRMZM2G589696_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.12e-39Dof family protein