PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G532534_P01
Common NameZEAMMB73_396589, Zm.55850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GATA
Protein Properties Length: 323aa    MW: 35293.5 Da    PI: 8.1822
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G532534_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.53.8e-18131164134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        C++C + +Tp+WR+gp g++tLCnaCG+++++ +
  GRMZM2G532534_P01 131 CTHCASEETPQWRQGPAGPSTLCNACGVRFKSGR 164
                        *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.5E-15125175IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.899125161IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-13127189No hitNo description
Gene3DG3DSA:3.30.50.106.1E-14129162IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.24E-13130179No hitNo description
PROSITE patternPS003440131156IPR000679Zinc finger, GATA-type
PfamPF003207.0E-16131164IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAGCGAAADE NPAAEELASG ADASLNAFFD HAGLELAAAA GGGQGADDDE EEELEWLSNM  60
DAFPSVETMS AEVEAAPSAA PPARLEPLPH ASHAVGPRTK GLRRRRRVTA PWSVPPVLPP  120
PAGSGAPRRR CTHCASEETP QWRQGPAGPS TLCNACGVRF KSGRLFPEYR PILSPTFSPL  180
LHSNSHRRVM EMRRHPVGIG WDGTEESQSW RAWEESIHGG RHVCHSTAFA FCFAWEEHTI  240
STGFCFRLPM SDEAGKSRSS STYHTRKRRR DGRLRCTVRG YMLLPRLSVA VQRFLSFFFP  300
PGTGSGDGDW QRARGRRSQV AAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265269RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.862581e-179endosperm
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G532534
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G532534_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0184181e-177BT018418.1 Zea mays clone EL01N0356F04.d mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020400002.11e-137GATA transcription factor 4
TrEMBLA0A1D6PJR41e-135A0A1D6PJR4_MAIZE; Putative GATA transcription factor family protein
TrEMBLA0A3L6DH641e-135A0A3L6DH64_MAIZE; GATA transcription factor 10
STRINGGRMZM2G532534_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-30GATA transcription factor 11