PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G478417_P01
Common NameZm.133210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 350aa    MW: 36938.7 Da    PI: 6.9281
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G478417_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.31.1e-15272324557
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                        +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ee+ ++ +
  GRMZM2G478417_P01 272 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNEELQKKQEEIMEMQK 324
                        79********************************************9999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.4E-15267319No hitNo description
SMARTSM003384.1E-14268332IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.484270321IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.0E-11272321No hitNo description
CDDcd147076.55E-26272326No hitNo description
PfamPF001702.9E-13272324IPR004827Basic-leucine zipper domain
PROSITE patternPS000360275290IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0020136anatomyear inflorescence
PO:0001052developmental stagevascular leaf expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007065developmental stageLP.05 five leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDLKDSERRG AAGPGPLSRQ GSIYSLTFDE FQNTLGGTGG GLGKDFGSMN MDELLRSIWT  60
AEESQAMASA SEPAAGAAGD GGAALQRQGS LTLPRTLSVK TVDEVWRDFA REGTAGGPEP  120
QPNRQPTLGE MTLEDFLVRA GVVRDNPAAA AAAAAAVPAQ PVATRPLQAV NNGASIFFGN  180
FGGANDAGAG AMGFAPVGIG DQAMGNGLMP GVAGMAAGAV TVSPVDMSVA QLDSMGKGNG  240
DLSSPMAPVP YPFEGVIRGR RSGAGVEKVV ERRQRRMIKN RESAARSRAR KQAYTMELEA  300
EVQKLKEQNE ELQKKQEEIM EMQKNQVVEV ISNPYAQKKR CLRRTLTGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.989600.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G478417
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves and embryos. {ECO:0000269|PubMed:10611387}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G478417_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396520.0BT039652.1 Zea mays full-length cDNA clone ZM_BFc0037E11 mRNA, complete cds.
GenBankEU9647680.0EU964768.1 Zea mays clone 281458 bZIP transcription factor ABI5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664522.20.0bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-155TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A1D6KL990.0A0A1D6KL99_MAIZE; ABSCISIC ACID-INSENSITIVE 5-like protein 5
STRINGGRMZM2G157722_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.12e-32ABRE binding factor 4
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]