PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G477415_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 221aa    MW: 23801.9 Da    PI: 9.3369
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G477415_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.68.7e-1886140256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tk q + Le+ F+ ++ +s ++++eLA++++L+ rqV vWFqNrRa+ k
  GRMZM2G477415_P01  86 RKKLRLTKAQSTLLEDTFRAHSILSNAQKQELARQVDLSARQVEVWFQNRRARTK 140
                        788899***********************************************98 PP

2HD-ZIP_I/II108.45e-3586173188
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                        +kk+rl+k q++lLE++F++++ L++ +K+elar+++l++rqv+vWFqnrRARtk+kq+E d+e Lkr++++l+ en+rL+ e ++L+
  GRMZM2G477415_P01  86 RKKLRLTKAQSTLLEDTFRAHSILSNAQKQELARQVDLSARQVEVWFQNRRARTKLKQTEADCEILKRCCESLTGENQRLRLELAQLQ 173
                        69**********************************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575126No hitNo description
PROSITE profilePS5007116.97382142IPR001356Homeobox domain
SuperFamilySSF466897.1E-1883150IPR009057Homeodomain-like
SMARTSM003892.9E-1384146IPR001356Homeobox domain
CDDcd000865.60E-1486143No hitNo description
PfamPF000463.2E-1586140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1786147IPR009057Homeodomain-like
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
SMARTSM003409.0E-13142185IPR003106Leucine zipper, homeobox-associated
PfamPF021833.5E-9142174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MYSTREEEGV GKSWLGLGIG GGSGGCDLMQ RNNRPPVQFD LLFPPQGVVE GVAASKKAEK  60
GGGGRKRLKV VTGTADEDGQ QPPGARKKLR LTKAQSTLLE DTFRAHSILS NAQKQELARQ  120
VDLSARQVEV WFQNRRARTK LKQTEADCEI LKRCCESLTG ENQRLRLELA QLQGSEAGLY  180
LQSSFPPLAA AMASVCPSCD KVITVASGGE TSGRSSTSYS S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G477415
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G477415_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554313e-64EU955431.1 Zea mays clone 1531862 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020393254.11e-161homeobox-leucine zipper protein HOX18
SwissprotA2YGL91e-47HOX18_ORYSI; Homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F61e-47HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A1D6GUM41e-159A0A1D6GUM4_MAIZE; Homeobox-leucine zipper protein HAT9
TrEMBLA0A3L6EQ071e-159A0A3L6EQ07_MAIZE; Homeobox-leucine zipper protein HOX18
STRINGGRMZM2G477415_P011e-160(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-42HD-ZIP family protein