PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G470974_P01
Common NameLOC103640680, ZEAMMB73_317019, ZHD10, Zm.32437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ZF-HD
Protein Properties Length: 98aa    MW: 10100.1 Da    PI: 7.3128
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G470974_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.11.8e-322682259
        ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                       + vrY+eC++NhAaslGghavDGC+Efm++ g++gtaaal CaACgCHR+FHRreve+
  GRMZM2G470974_P01 26 KVVRYRECQRNHAASLGGHAVDGCREFMAA-GADGTAAALACAACGCHRSFHRREVEQ 82
                       579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-102596IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.5E-302880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-262980IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.2763079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGPQQGRRSN GGAAARSKQE EEGGAKVVRY RECQRNHAAS LGGHAVDGCR EFMAAGADGT  60
AAALACAACG CHRSFHRREV EQPAADCDCD CSSTTSGA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1395291e-151meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G470974
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G470974_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269791e-163KJ726979.1 Zea mays clone pUT3680 ZF-HD transcription factor (ZHD10) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008662385.14e-64mini zinc finger protein 1
SwissprotB8BIU82e-32MIF1_ORYSI; Mini zinc finger protein 1
SwissprotB8BLT32e-32MIF2_ORYSI; Mini zinc finger protein 2
SwissprotB9GBM32e-32MIF2_ORYSJ; Mini zinc finger protein 2
SwissprotQ2RB282e-32MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLK7TI801e-62K7TI80_MAIZE; Mini zinc finger protein 3
STRINGGRMZM2G470974_P012e-63(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-16mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]