PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G463525_P01
Common NameZm.30240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 618aa    MW: 67070.9 Da    PI: 8.8988
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G463525_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.55.9e-38243302261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GG++rnvPvG+grr+nk  
  GRMZM2G463525_P01 243 PDKILPCPRCNSMETKFCYFNNYNVNQPRHFCRNCKRYWTAGGTMRNVPVGSGRRRNKDP 302
                        7899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30240300IPR003851Zinc finger, Dof-type
PfamPF027012.5E-31245301IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.649247301IPR003851Zinc finger, Dof-type
PROSITE patternPS013610249285IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MAAPGGLDQD CAQDAAIKLF GRSIPVLHSS VFAATAAAAS ECLYGNFLPI RVSSTSHSPY  60
LRPYLWGDLC WFIPYPDSNH KDTLPLSVEK SLRIFLFSWG LILLDISALA YFYSRTNNLL  120
KSKSTSSNNL SCVAWNANHV THWVVLVSTK LSNDVRSNDG MPCLPNMSLI VKTNPFPSKS  180
NMKNGLQAIS SQHGKMEADS NSEEAKNSLQ AIISQPGKRY DSKSEEAKTE SGGSGQEKVL  240
KKPDKILPCP RCNSMETKFC YFNNYNVNQP RHFCRNCKRY WTAGGTMRNV PVGSGRRRNK  300
DPSHHHHFTK VCDYTIATNG DVSDATQRQS VAAKPCLLQG SGKQNETACK SVSPVSNIKE  360
QNNADLISLV SGDNKEEKSC ASSAVVSGSS ENWMPENTVK KEEDNTSAYG NGVKVPDHKM  420
QPHHAGPVSV FSRNPAAVMA TNQCSEDGIH TPGNGTVSPL SLPPLPMVPT PGICAPAVPF  480
PFPLVPAFVS CIPGWPSGLW GAPWPGSSAP TLLSLPPNGL ALSGSNSGVL GKHTRVANLQ  540
EEQKAEKKFW VPKALRIDNP EEAAKSSIWA SLGIKPDDRI IFKSFQSKDL KNSATKTPES  600
LQANPAAFSR SQTFQERA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.302400.0meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G463525
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G463525_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0846380.0BT084638.2 Zea mays full-length cDNA clone ZM_BFb0150D22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008673918.10.0cyclic dof factor 2
TrEMBLA0A1D6MQV20.0A0A1D6MQV2_MAIZE; Cyclic dof factor 2
STRINGGRMZM2G463525_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-40cycling DOF factor 2