PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G456452_P01
Common NameDOF13, LOC100277177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 249aa    MW: 24921.8 Da    PI: 9.4785
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G456452_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.42.7e-3278132559
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                         ++cprC s+ntkfCyynnys +qPry+CkaCrr+Wt+GG+lr+vPvGggr++++
  GRMZM2G456452_P01  78 PRQCPRCRSANTKFCYYNNYSREQPRYLCKACRRHWTEGGTLRDVPVGGGRKNRR 132
                        679**********************************************987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088425.92879133IPR003851Zinc finger, Dof-type
PfamPF027016.3E-3079131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-1686124IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MPSSFLTSSS SSASSHLSYL IPARAAPPPP FAMGQGYGAT SGGGVANATS AAAAPPPPRQ  60
GASRNAGAGH PPLPRPPPRQ CPRCRSANTK FCYYNNYSRE QPRYLCKACR RHWTEGGTLR  120
DVPVGGGRKN RRGAKGGAAA KGSASAAAAA PAQQGGNVLG ADTFPGDLLR QLVQFQPDAA  180
VGGGGYAIDL SAWHQMVAAT APPPPPPGTG GDVSSLGLGA AGAGAGAEAN CVALQYWSED  240
GMPGLDGAC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1226960.0root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G456452
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G456452_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279850.0KJ727985.1 Zea mays clone pUT6101 C2C2-DOF transcription factor (DOF13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008671066.11e-176uncharacterized protein LOC100277177 isoform X1
RefseqXP_008671079.11e-176uncharacterized protein LOC100277177 isoform X1
RefseqXP_023157574.11e-176uncharacterized protein LOC100277177 isoform X1
RefseqXP_023157575.11e-176uncharacterized protein LOC100277177 isoform X1
TrEMBLA0A060CY741e-175A0A060CY74_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G456452_P011e-176(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.16e-18Dof family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]