PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G449950_P01
Common NameDOF9, ZEAMMB73_629493, Zm.66956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 253aa    MW: 25806 Da    PI: 8.7371
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G449950_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.1e-393997462
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+ss
  GRMZM2G449950_P01 39 AAVKCPRCESTNTKFCYYNNYNLSQPRHFCKGCRRYWTKGGVLRNVPVGGGCRKAKRSS 97
                       679****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.8E-334095IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-274195IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2084195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0004006anatomymesophyll cell
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAAA AGLRRAQGQC GGGGASAAAA VKCPRCESTN TKFCYYNNYN  60
LSQPRHFCKG CRRYWTKGGV LRNVPVGGGC RKAKRSSAPS TPTPTPTSAV GDAKSPRRAS  120
ASSPRGSISS GSGSASPTPN GFAFSSTADV VAPPPAPIFA DQAAALASLF APPPPLPAFS  180
FVAAQAKEET SSTPAGFAAP YSSVSEDMAP FASLDAAGMF EIGEDASAAA AYWNAGSCWT  240
DVPDPSMMMY LLP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.669560.0meristem| ovary| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G449950
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G449950_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280400.0KJ728040.1 Zea mays clone pUT6185 C2C2-DOF transcription factor (DOF9) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142926.11e-120uncharacterized LOC100275361
TrEMBLK7U8931e-180K7U893_MAIZE; C2C2-DOF transcription factor
STRINGGRMZM2G449950_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-34OBF binding protein 4