PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G441115_P01
Common NameZEAMMB73_170114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family M-type_MADS
Protein Properties Length: 289aa    MW: 32005.8 Da    PI: 6.5695
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G441115_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.3e-22953145
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       kr en+s rqvt+skRr gilKKA+ELS+LCd++  +i+fs+t+k
  GRMZM2G441115_P01  9 KRLENNSGRQVTYSKRRSGILKKAKELSILCDIDLMLIMFSPTDK 53
                       789***************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.572153IPR002100Transcription factor, MADS-box
CDDcd001206.72E-25254No hitNo description
SuperFamilySSF554552.09E-25287IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0001180developmental stageplant proembryo stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRVKLKIKR LENNSGRQVT YSKRRSGILK KAKELSILCD IDLMLIMFSP TDKPTICIGD  60
RSTLEEVVAK YTQLTPQERA KRVQTVEGNF GKQHLIGLQY AATQFQTDMQ LPLGLPGESG  120
PSSWFQNGGA DGQQAMMLTD ESGLLHQRDI AQGYPSYFST VKQDPDTGGS SSDHGQVVLH  180
HPQPPDFSQT ECLTSLHLPS QQFPYPPFDH HGLYSDRIFR PDAVELHAGG VASMDFLSGQ  240
YDLPRPGDDA SFHNWASAAA CSATMFDQQQ QQQHQHHQQP QSSPAQVSA
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G441115
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G441115_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677900.11e-136agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_008677901.11e-136agamous-like MADS-box protein AGL65 isoform X1
TrEMBLA0A1D6PNS21e-134A0A1D6PNS2_MAIZE; Putative MADS-box transcription factor family protein
STRINGGRMZM2G441115_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.23e-37AGAMOUS-like 30