PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G438293_P01
Common NameZEAMMB73_594588, Zm.92530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 238aa    MW: 24922 Da    PI: 5.5233
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G438293_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.53e-13179223347
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                        +++re+r++kNRe+A rsR+RK+a+i+eLe  v  L +e  +L  
  GRMZM2G438293_P01 179 AIQREKRMIKNRESAARSRERKQAYIAELEYMVTRLAEEKAELLR 223
                        789************************************987764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-5177238IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.818179227IPR004827Basic-leucine zipper domain
PfamPF001703.0E-11179224IPR004827Basic-leucine zipper domain
CDDcd147073.76E-20181228No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-12182226No hitNo description
SuperFamilySSF579591.55E-9182227No hitNo description
PROSITE patternPS000360184199IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MASSRVIPSS SPSHTASDLA RLAQAASRPG GGGSGPGSMN VEELLRGIYS DMPTPAPPAS  60
EPGRPMPPAP APVSATRKTA EEVWKEITGG GGSGEAVAPV AAQAVAPDGG AGTGGPEVTL  120
EDFLARESAV KEDEVKISVP PAPVMGLPGG AEGVSVPGGG GGRERKRQLV STVDRARSAI  180
QREKRMIKNR ESAARSRERK QAYIAELEYM VTRLAEEKAE LLRQQEEQFQ TRLEEVTF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.925300.0ear| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G438293
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G438293_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9722260.0EU972226.1 Zea mays clone 378047 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008657022.11e-164PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 4
TrEMBLK7V7261e-166K7V726_MAIZE; Putative bZIP transcription factor superfamily protein (Fragment)
STRINGGRMZM2G438293_P011e-166(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9845410
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-14G-box binding factor 4