PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G435475_P01
Common NameDOF10, LOC100275252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 231aa    MW: 24175.2 Da    PI: 10.2572
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G435475_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.97.8e-3772129360
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        e+ l+cprC s++tkfCy+nny+++qPr+fC+aC+ryWt+GGa+rnvPvG+grrkn+ 
  GRMZM2G435475_P01  72 EARLPCPRCLSRDTKFCYFNNYNVNQPRHFCRACHRYWTAGGAIRNVPVGSGRRKNRP 129
                        56789**************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.5E-3074128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2375129IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-2476128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007031developmental stagemid whole plant fruit ripening stage
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MLPPHVEMPT TRAAGIKLFG KVITTHYQQQ QQPPQPVRHA GAAPASSGRG SGGGPGPDLL  60
EEVARARAAA AEARLPCPRC LSRDTKFCYF NNYNVNQPRH FCRACHRYWT AGGAIRNVPV  120
GSGRRKNRPV LLPPPPPPPH AATATTTGSS ATISADDSND RRRSASGSPP PVFTSAFTAP  180
YYLGSPAQFA TSSPAYAAGA AGPPGTAGQC LWLVAATTTT DRSAATETAL F
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G435475
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G435475_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9550110.0EU955011.1 Zea mays clone 1501573 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142858.11e-166uncharacterized protein LOC100275252
TrEMBLB6SQJ61e-165B6SQJ6_MAIZE; C2C2-DOF transcription factor
STRINGGRMZM2G435475_P011e-166(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.14e-31Dof family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]