PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G414159_P01
Common NameLOC100381416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Trihelix
Protein Properties Length: 777aa    MW: 82583.3 Da    PI: 6.5221
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G414159_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.99e-31100184187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW++qe+l+L+++r++m++++r++ lk+plWe+vs+k++e+g++rs+k+Ckek+en++k+yk++ke++ +r  ++ +t+++f+qlea
  GRMZM2G414159_P01 100 RWPRQETLELLKIRSDMDTAFRDATLKAPLWEQVSRKLAEKGYNRSAKKCKEKFENVHKYYKRTKESRAGR--NDGKTYRFFTQLEA 184
                        8********************************************************************97..56668*******85 PP

2trihelix107.58.7e-34472557187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k ev+aLi++r+ +++r++++  k+plWee+s+ mr  g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  GRMZM2G414159_P01 472 RWPKAEVHALIQLRSTLDTRYQETGPKGPLWEEISAGMRGMGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 557
                        8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.001797159IPR001005SANT/Myb domain
CDDcd122031.17E-2899164No hitNo description
PfamPF138376.9E-2199185No hitNo description
PROSITE profilePS500906.7699157IPR017877Myb-like domain
SMARTSM007170.0013469531IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-4470528IPR009057Homeodomain-like
CDDcd122031.12E-30471536No hitNo description
PROSITE profilePS500907.108471529IPR017877Myb-like domain
PfamPF138372.1E-23471558No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007015developmental stageradicle emergence stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MQQQQHGGGG GASGGGPAQQ FCAQQVEMPL PFSPVGGAGQ RISLAEAPSP ISSRPPAPAP  60
AQQYDELGPS GAGAVGFDAE GLAAAAAGED GASGGSAGNR WPRQETLELL KIRSDMDTAF  120
RDATLKAPLW EQVSRKLAEK GYNRSAKKCK EKFENVHKYY KRTKESRAGR NDGKTYRFFT  180
QLEALHGTGA APASVASQVG PAISGGVSGA ARPSSAVRVP AEPLPAVSAG VGMPMTTTVG  240
YPSISTSNTE DDYTDEDDSD DEGTEELVGG GADDQRRKRK RVSDGSGKMM RFFEGLMKHV  300
MDRQEAMQQR FLEAIEKREQ DRMIREEAWR RQEMTRLARE QEILAQERSM AASRDAAVLS  360
FIQKITGQTI PMPSIAAPTI NAMPPPSHPK PPPPPQPHPT PIASVSPAPP PPQPPASQTP  420
PPQQQKSPMP ATPQTPAPQR QSTDIVMTPA ETTPHADTQG HEGSGGGATS SRWPKAEVHA  480
LIQLRSTLDT RYQETGPKGP LWEEISAGMR GMGYNRNAKR CKEKWENINK YFKKVKESNK  540
KRPEDSKTCP YFHQLDALYR NKAAITSSSG AGAMVHANAS SAPQEMVTVT AATPISQTPP  600
PPTQPSQSHH AAKNGGSSNS AGTGTGNGSY ASEHGSRGMQ TQASNGSAAA SMFVGLGGGA  660
ASAAKKPEEI MKEMIEQRQP QQPQAVVGGY NRMDGAGSNN MDDDDDDDED DYDENDNDED  720
DAGNKMQYEI QFQHHHQHPN VVRSNAGAGG GNPPGTTAPS TAAAPTTTAG SFLGMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275280RRKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.316740.0endosperm
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G414159
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G414159_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0612050.0BT061205.1 Zea mays full-length cDNA clone ZM_BFb0123A12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001167728.10.0uncharacterized protein LOC100381416
RefseqXP_008643913.10.0uncharacterized protein LOC100381416 isoform X1
TrEMBLC0HFU90.0C0HFU9_MAIZE; Trihelix transcription factor GT-2
STRINGGRMZM2G414159_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.14e-70Trihelix family protein