PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G402862_P01
Common NameLOC100191685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 161aa    MW: 17874.2 Da    PI: 9.6085
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G402862_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.6e-1789145359
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                        +++r +r+++NRe+A rsR+RK+a++e+Le++v  L   N +Lkk+ +elk eva+l
  GRMZM2G402862_P01  89 DDRRSIRMMRNRESALRSRARKRAYVENLEKEVRRLVDDNLKLKKQCKELKREVAAL 145
                        5799*************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-1684145No hitNo description
SMARTSM003381.7E-1487151IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.71489145IPR004827Basic-leucine zipper domain
PfamPF001702.3E-1490145IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.24E-1291145No hitNo description
CDDcd147071.61E-1691145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MAANYHHYQM AVHAAAAAAA WRREPDSPQL SFVSGCSSLF SISTLQDDDD DRAAAVVIAA  60
GHALPSTPVS LAGFVGDEVD MEVQQASGDD RRSIRMMRNR ESALRSRARK RAYVENLEKE  120
VRRLVDDNLK LKKQCKELKR EVAALVLPTK SSLRRTSSTQ F
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G402862
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G402862_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0338580.0BT033858.1 Zea mays full-length cDNA clone ZM_BFc0165B20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001354045.11e-115uncharacterized protein LOC100191685
TrEMBLA0A3L6EJC41e-114A0A3L6EJC4_MAIZE; Protein FD
TrEMBLB4F9S01e-114B4F9S0_MAIZE; BZIP transcription factor TRAB1
TrEMBLK4JFJ81e-114K4JFJ8_MAIZE; BZIP-type transcription factor (Fragment)
STRINGGRMZM2G402862_P011e-115(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Representative plantOGRP9528513
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-15bZIP family protein