PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G394941_P01
Common NameDOF42, LOC103627668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 300aa    MW: 30315.5 Da    PI: 8.2095
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G394941_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3947105361
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k++
  GRMZM2G394941_P01  47 PEAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRA 105
                        5789***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2937104IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3349104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.32950104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAAA PGDLRRAQAA QHGPGGARCG GASPAAPEAV KCPRCESTNT  60
KFCYYNNYNL SQPRHFCKSC RRYWTKGGVL RNVPVGGGCR KAKRASPSAS ASASSPASSS  120
APSTPASADA AKNPRRASAS PRSNSGSASP TAAAATTPTP TDPSTSATPS SNGVAFTGSH  180
HSSNPFSTID VAAAPPAPIF ADQAAALASL FAPPPPPPLP VFSFAAAQPK EEEAPTNSEL  240
QQHLAAQAAP SSSVSEDIMA PFASLDAAGI FELGDAASAA AYWSAGSCWA DVQDPSLYLP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.669563e-77meristem| ovary| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G394941
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in germinating seeds up to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G394941_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2102600.0AC210260.5 Zea mays BAC clone CH201-44F4 from chromosome 5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008646182.10.0dof zinc finger protein 4
SwissprotQ6Z3452e-84DOF4_ORYSJ; Dof zinc finger protein 4
TrEMBLA0A060D2490.0A0A060D249_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G394941_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-35OBF binding protein 4
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]