PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G378490_P01
Common NameDOF7, LOC107325937, Zm.34442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 231aa    MW: 23661.9 Da    PI: 10.0144
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G378490_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.18.1e-384096359
             zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                        + l+cprC+s+ntkfCyynny+lsqPryfC+aCrryWt+GGalrnvPvGgg+rk  
  GRMZM2G378490_P01 40 PEGLPCPRCESANTKFCYYNNYNLSQPRYFCRACRRYWTRGGALRNVPVGGGTRKAT 96
                       57899*************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-233991IPR003851Zinc finger, Dof-type
PfamPF027018.4E-334395IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8264397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MVRSSAATEV GQVPDGRPLP APVATGGGGG GTGTGGGREP EGLPCPRCES ANTKFCYYNN  60
YNLSQPRYFC RACRRYWTRG GALRNVPVGG GTRKATPAGR RKRAGPAPAT AAPPAPPPPS  120
ALHGSLLRPY GGLSFAAPAL ASPLAAVDPD RRLLDLGGSF TSLIAPGADV GVHFSAEFLV  180
GGLAPAALPR ATASVPALPP PPPQQHQQPT TVSQALPEGL FWSMGWPDLS I
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.344420.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G378490
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G378490_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0619500.0BT061950.2 Zea mays full-length cDNA clone ZM_BFb0200H06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307837.11e-162uncharacterized protein LOC107325937
TrEMBLA0A060D5B91e-161A0A060D5B9_MAIZE; C2C2-DOF transcription factor (Fragment)
TrEMBLA0A3L6FH851e-161A0A3L6FH85_MAIZE; Dof zinc finger protein DOF2.2
STRINGGRMZM2G378490_P011e-161(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-30DOF zinc finger protein 1