PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G370863_P01
Common NameLOC103653502, ZEAMMB73_925953, ZHD19, Zm.20478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ZF-HD
Protein Properties Length: 127aa    MW: 13351.2 Da    PI: 7.6021
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G370863_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.71.6e-293085359
        ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                       +vrY eC++NhAas+GghavDGC+Ef+++ geegtaa l+CaACgCHR+FHRr v+ 
  GRMZM2G370863_P01 30 GVRYGECRRNHAASMGGHAVDGCREFLAE-GEEGTAAVLHCAACGCHRSFHRRMVQR 85
                       69**************************8.999********************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576125No hitNo description
ProDomPD1257747.0E-19193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-283182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.4E-243281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.7663382IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MMKRMVIVRR CHPPPPPPVL LFGGCPSAGG VRYGECRRNH AASMGGHAVD GCREFLAEGE  60
EGTAAVLHCA ACGCHRSFHR RMVQRSCCFC CDSADVAVAA AAAAAAAAER WDDDCSPESS  120
ASSSTPR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.204781e-179meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G370863
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G370863_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270080.0KJ727008.1 Zea mays clone pUT3984 ZF-HD transcription factor (ZHD19) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008678616.12e-86mini zinc finger protein 4
SwissprotQ0J5F81e-33MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLA0A3L6F4Z05e-85A0A3L6F4Z0_MAIZE; Mini zinc finger protein 4
TrEMBLK7TWH75e-85K7TWH7_MAIZE; Mini zinc finger protein 2
STRINGGRMZM2G370863_P018e-86(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-26mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]