PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G358796_P01
Common NameLOC103632894, Zm.8806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 195aa    MW: 21685 Da    PI: 10.5594
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G358796_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.35.8e-1294153362
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                        + +r rr+++NRe+ArrsR RK+ ++ eL   v  L + N++L +el++    ++ ++ e
  GRMZM2G358796_P01  94 AERRRRRMASNRESARRSRMRKQRQLTELWAQVVHLRGANRRLLDELNRAVRGCSDMRRE 153
                        56899*******************************************988888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-1192156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-893148No hitNo description
PfamPF001701.2E-994153IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.17494157IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.13E-1096144No hitNo description
PROSITE patternPS00036099114IPR004827Basic-leucine zipper domain
CDDcd147024.25E-13101143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MLHQHQHHYH GGVASLHSYL SNPDQAFHAH YYHHSNIIAT PLPPTPSFHH LWPSTAQTFE  60
QPVVHEAPAA VAAGNSPAGS GSADDGGGGG TAEAERRRRR MASNRESARR SRMRKQRQLT  120
ELWAQVVHLR GANRRLLDEL NRAVRGCSDM RREKARLQKE KTDLGTKLQR LTQPQNAALP  180
SSSSEPQPQH DAATE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108115RRSRMRKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G358796
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G358796_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652831.11e-142basic leucine zipper 8
TrEMBLA0A1D6I6H21e-141A0A1D6I6H2_MAIZE; Basic leucine-zipper 58
STRINGGRMZM2G358796_P011e-142(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Representative plantOGRP1312045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.14e-08basic leucine-zipper 48