PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G348238_P01
Common NameLOC107522107, Zm.30973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family G2-like
Protein Properties Length: 499aa    MW: 52172 Da    PI: 6.1737
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G348238_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31274329156
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                        k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GRMZM2G348238_P01 274 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 329
                        68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.69271331IPR017930Myb domain
SuperFamilySSF466892.69E-17271332IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28272332IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-26274329IPR006447Myb domain, plants
PfamPF002491.1E-6276327IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020127anatomyprimary root
PO:0007015developmental stageradicle emergence stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MASSPSDLTL DYKPNGNGAA YAVTTPKPPQ ETLVVDGHHH HHHLTAAEQT TQKLREFLAR  60
LEEERLKIDA FKRELPLCMQ LLNHAMESYR QQLEAYQMGS LQGAPARPLV LEEFMPLKNI  120
GIDAAADKMG NPTSEKASWM ESAQLWNGPA ATADVAARGP QTPKESAECA HGAAGAGHGQ  180
RNGGGGGGAF LPFAKDKTAS AAEGAALPEL ALAPADKDAA DADRKPYLDA AAGSNNGGVL  240
GSRRDAVQSG VVNVKPAPNA PEGQQAAPPQ THRKARRCWS PELHRRFVNA LQILGGAQVA  300
TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPMPAPPAP ATAAPQLVVL GGIWVPPEYA  360
SQAAGQAIYG AHPATQPHYT AAAAQEYYPS PAAVHHLQHH PAAAAMVHRA AAAPPPPQQA  420
AYSKAAAMAG SPPGSEGRGS AGGGSIGGGG GRERSESIEE EGEVEEREED DEDDDDDMTA  480
NKADGEGAAA GAGVGAAMY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-14274327255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G348238
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G348238_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865720.0BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001309287.10.0uncharacterized protein LOC107522107
SwissprotQ5VRW21e-132NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A1D6MJX40.0A0A1D6MJX4_MAIZE; Myb family transcription factor EFM
STRINGGRMZM2G348238_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-45G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]