PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G332294_P01
Common NameLOC100193658
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 374aa    MW: 39757.2 Da    PI: 5.6849
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G332294_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.94.3e-08194252563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        k+++r + NR +A rs +RK  +i+eLe+kv+ ++   +aL+ +l  l+   a l+ e+
  GRMZM2G332294_P01 194 KKAKRIINNRQSAARSKERKMRYIAELERKVQFMQRDATALATQLALLQRDTAGLTVEN 252
                        89*******************************************99999998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-14190254IPR004827Basic-leucine zipper domain
PfamPF077163.0E-7192243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.208192255IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-9194248No hitNo description
Gene3DG3DSA:1.20.5.1705.0E-8194248No hitNo description
CDDcd147032.03E-21195246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MNMDKTPIAG GGGGGGDDDD DAGNGPEIQS SSDAVAPSPT PHTECDISSM PDSPLRKPGH  60
RRALSEIIGL PDDLDLGAPG AGDAPALSDE NEEELFSMFL DVDKLNSRCG SSESESSSCA  120
MAGGGRGEAT EASAAPGAEQ LGQRHHHRHS MDASSSINAE HLFGTTAMEG ASPAEVKRAM  180
SAAKLAELAL IDPKKAKRII NNRQSAARSK ERKMRYIAEL ERKVQFMQRD ATALATQLAL  240
LQRDTAGLTV ENSELKIRLQ STEQQIHLQD ALNEALKSEL QRLKVATGQM GSQMMGFAGP  300
PHPFGGGNQQ AFHHPSQAVP PFLAMQQQQQ HPHHPLHPLQ QTQALSLNMK GPPAAPPAGQ  360
WQWGGDAWSE SSSS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G332294
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G332294_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0359850.0BT035985.1 Zea mays full-length cDNA clone ZM_BFb0090M08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132223.10.0uncharacterized protein LOC100193658
SwissprotQ69IL41e-103RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A317Y7220.0A0A317Y722_MAIZE; Transcription factor RF2a
TrEMBLB4FFU70.0B4FFU7_MAIZE; Uncharacterized protein
TrEMBLK4JE710.0K4JE71_MAIZE; BZIP-type transcription factor (Fragment)
STRINGGRMZM2G332294_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.52e-60bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]