PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G314064_P01
Common NameHB130, LOC103634590, Zm.135674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 314aa    MW: 32015.5 Da    PI: 6.7779
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G314064_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.92.2e-153595257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  GRMZM2G314064_P01 35 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 95
                       89*****************99*************************************997 PP

2Wus_type_Homeobox107.21e-343497265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ar+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
  GRMZM2G314064_P01 34 ARSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 97
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.22E-1429103IPR009057Homeodomain-like
PROSITE profilePS5007111.3533196IPR001356Homeobox domain
SMARTSM003893.0E-733100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-934102IPR009057Homeodomain-like
PfamPF000464.3E-133595IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEGGSNSPDG QSSGGSPEER GSGGSGGRGT GEPARSRWTP KPEQILILES IFNSGMVNPP  60
KDETVRIRKL LERFGAVGDA NVFYWFQNRR SRSRRRQRQM QAAAAAAAAA AASSASNNSS  120
PAASATVGLP SGALQYPLAM GGTAACQYEQ QASSSSSSGS TGGSSLGLFA LGAAGVPGTG  180
GGGYFQASCG ASSPLATGLM GDVDSSGGSD DLFAISRQMG FAAASTVASA SVAPSSNAHH  240
QQYYSCESPA ATITVFINGV PMEVPRGPID LRAMFGQDVM LVHSTGVILP VNDYGILTQT  300
LQLGESYFLV ARPT
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G314064
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G314064_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284130.0KJ728413.1 Zea mays clone pUT6718 HB transcription factor (HB130) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008655176.10.0PREDICTED: WUSCHEL-related homeobox 6-like
SwissprotA2XG771e-109WOX6_ORYSI; WUSCHEL-related homeobox 6
TrEMBLA0A060D9470.0A0A060D947_MAIZE; HB transcription factor (Fragment)
STRINGGRMZM2G314064_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1277145
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.28e-30WUSCHEL related homeobox 12