PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G313078_P01
Common NameLOC103630560, Zm.139045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 426aa    MW: 45514.7 Da    PI: 6.5092
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G313078_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS270.84.4e-83344232373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsv....selykalppsetsekn.sseelaalkl..fse 86 
                        ++lLl+cA a++s+d +laq++++ l+++as++gdp qRl++ +++AL ar  r +    s++ +a ++ ++++    ++++++++l  +++
  GRMZM2G313078_P01  34 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPSQRLTSWLLRALVARACRLCappgSTTQSAAAAAAARTPApRERAMSVTELaeYVD 125
                        699***********************************************998854111133333333333333333444444445588*** PP

               GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                        + P+++f++ + N aIl+av g+ +vH++D++++ ++QWp+L++ L++Rp+gpp+lRiT+ ++  ++      +  e+g rLa+fA++ gv+
  GRMZM2G313078_P01 126 LMPWHRFGFTASNGAILRAVVGSAAVHVVDLSVTRCMQWPTLIDMLSKRPGGPPELRITVPSARPAVppqLGVSDAEIGLRLANFAKSKGVQ 217
                        ***********************************************************999866668544455579*************** PP

               GRAS 176 fefnvl..............vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                        ++f+v+              ++++l+++  + ++L ++ gEal+Vn++  + ++       +  rd++L +v+ l+P +v+v++++ad++s+
  GRMZM2G313078_P01 218 LHFSVVegvtspppekqaaaLCQDLASVlsDRQALGLRDGEALVVNCQSWIRHVA------PGSRDAFLGAVRALNPCLVTVTDEDADLDSP 303
                        ********9**99998866655555554778999***************999997......555788************************* PP

               GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                        s+++r++ ++++++ lfd+l++++pr+s  r+  E++ +gr+i+ vv +  a+  er e+ ++  er+++ GF +v+++e+aa ++++ll++
  GRMZM2G313078_P01 304 SLATRIAGCFDFHWILFDALDTSAPRDSPRRAEHEAA-VGRKIEGVVGADDADGAERSESGARLAERMRRNGFVSVAFDEEAAGEVRRLLSE 394
                        ***********************************99.****************************************************** PP

               GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        ++  g+ ++ e++ lvl+Wk++  v +SaW
  GRMZM2G313078_P01 395 HA-TGWGMKREEDMLVLTWKGHGAVYTSAW 423
                        **.889999999****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.0667405IPR005202Transcription factor GRAS
PfamPF035141.5E-8034423IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MEQELRTGGR GGGNLRAHSS ACLSGALIDG PRIQQLLLHC AAALESNDVT LAQQAMWVLN  60
NIASSQGDPS QRLTSWLLRA LVARACRLCA PPGSTTQSAA AAAAARTPAP RERAMSVTEL  120
AEYVDLMPWH RFGFTASNGA ILRAVVGSAA VHVVDLSVTR CMQWPTLIDM LSKRPGGPPE  180
LRITVPSARP AVPPQLGVSD AEIGLRLANF AKSKGVQLHF SVVEGVTSPP PEKQAAALCQ  240
DLASVLSDRQ ALGLRDGEAL VVNCQSWIRH VAPGSRDAFL GAVRALNPCL VTVTDEDADL  300
DSPSLATRIA GCFDFHWILF DALDTSAPRD SPRRAEHEAA VGRKIEGVVG ADDADGAERS  360
ESGARLAERM RRNGFVSVAF DEEAAGEVRR LLSEHATGWG MKREEDMLVL TWKGHGAVYT  420
SAWMPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-533642690475Protein SHORT-ROOT
5b3h_B5e-543642636421Protein SHORT-ROOT
5b3h_E5e-543642636421Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1414851e-103meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G313078
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G313078_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270020.0KJ727002.1 Zea mays clone pUT3978 GRAS transcription factor (GRAS62) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008649831.10.0scarecrow-like protein 32
TrEMBLA0A1D6M7J80.0A0A1D6M7J8_MAIZE; Scarecrow-like protein 32
STRINGGRMZM2G313078_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.15e-97GRAS family protein