PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G307400_P01
Common NameLOC103626389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 223aa    MW: 24516.8 Da    PI: 10.2658
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G307400_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-1887141256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tk q + Le+ F+ ++ +s+++++eLA++++L+ rqV vWFqNrRa+ k
  GRMZM2G307400_P01  87 RKKLRLTKAQSTLLEDTFRAHNILSHAQKQELARQVNLSARQVEVWFQNRRARTK 141
                        788899***********************************************98 PP

2HD-ZIP_I/II106.81.7e-3487174188
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                        +kk+rl+k q++lLE++F++++ L++ +K+elar+++l++rqv+vWFqnrRARtk+kq+E d+e+Lkr +++l+ en+rL+ e ++L+
  GRMZM2G307400_P01  87 RKKLRLTKAQSTLLEDTFRAHNILSHAQKQELARQVNLSARQVEVWFQNRRARTKLKQTEADCEVLKRYCERLTGENQRLRLELAQLQ 174
                        69**********************************************************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.13E-1879144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-1881148IPR009057Homeodomain-like
PROSITE profilePS5007117.00683143IPR001356Homeobox domain
SMARTSM003893.9E-1485147IPR001356Homeobox domain
PfamPF000461.2E-1587141IPR001356Homeobox domain
CDDcd000861.43E-1387144No hitNo description
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
SMARTSM003401.3E-9143186IPR003106Leucine zipper, homeobox-associated
PfamPF021831.9E-7143174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MYSCTRAMEE EGVGKSWLGL GIGGGGDLMK RNNRPPVQLD DLLSFPPQSV AAASKKQAEK  60
GGGGRKRHKI VVTADEDGRQ SPHGGARKKL RLTKAQSTLL EDTFRAHNIL SHAQKQELAR  120
QVNLSARQVE VWFQNRRART KLKQTEADCE VLKRYCERLT GENQRLRLEL AQLQRSPAAE  180
EAGFYVQSSF PFPPLATAMA SVCPSCDKVV AVTSGKSSTS YSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G307400
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G307400_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554311e-60EU955431.1 Zea mays clone 1531862 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645010.11e-166homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F65e-48HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A3L6EFA61e-164A0A3L6EFA6_MAIZE; Homeobox-leucine zipper protein HOX18
STRINGGRMZM2G307400_P011e-165(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.14e-35homeobox protein 2