PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G307397_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 241aa    MW: 25859.1 Da    PI: 10.0089
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G307397_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.88e-1887141256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++t+eq + Le+ F+ ++ +s ++++eLA++++L+ rqV vWFqNrRa+ k
  GRMZM2G307397_P01  87 RKKLRLTNEQSTLLEDTFRAHNILSNAQKQELARQVDLSARQVEVWFQNRRARTK 141
                        788899***********************************************98 PP

2HD-ZIP_I/II110.71e-3587175189
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                        +kk+rl++eq++lLE++F++++ L++ +K+elar+++l++rqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+ en+rL+ e ++L++
  GRMZM2G307397_P01  87 RKKLRLTNEQSTLLEDTFRAHNILSNAQKQELARQVDLSARQVEVWFQNRRARTKLKQTEVDCEILKRCCESLTGENQRLRLELAQLQR 175
                        69************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-1868144IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1872144IPR009057Homeodomain-like
PROSITE profilePS5007117.32983143IPR001356Homeobox domain
SMARTSM003891.3E-1385147IPR001356Homeobox domain
PfamPF000463.3E-1587141IPR001356Homeobox domain
CDDcd000868.23E-1487144No hitNo description
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PfamPF021833.0E-9143174IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-13143186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEEEGVGKSW LALGIGGGDL MKRNNRPPVQ FDLLFPPQSV KEEGAASKKA EKGGGRKRLK  60
VVTADEDGRQ SPHGGPGPSD GSGAGARKKL RLTNEQSTLL EDTFRAHNIL SNAQKQELAR  120
QVDLSARQVE VWFQNRRART KLKQTEVDCE ILKRCCESLT GENQRLRLEL AQLQRSAAAA  180
AEAGLYVQSS FPPLATATAT ASVCPSCDKV IAVSSGGETS GKSSTSYSSR RAGFPSIMGS  240
R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G307397
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G307397_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554311e-106EU955431.1 Zea mays clone 1531862 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645009.11e-177homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F66e-51HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A1D6GUM61e-175A0A1D6GUM6_MAIZE; Homeobox-leucine zipper protein HAT9
TrEMBLA0A3L6EFY01e-175A0A3L6EFY0_MAIZE; Homeobox-leucine zipper protein HOX18
STRINGGRMZM2G307397_P011e-176(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-33HD-ZIP family protein