PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G180847_P01
Common NamebZIP65, TIDP3237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 371aa    MW: 39348.9 Da    PI: 6.3558
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G180847_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.4e-11183241563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        kr++r   NR +A rs +RK ++i eLe kv++L++e ++L  +l  l+     l++e+
  GRMZM2G180847_P01 183 KRAKRIWANRQSAARSKERKMQYIGELELKVQTLQTEATTLSAQLALLQRDTTGLTTEN 241
                        9********************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-16179243IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-9181237No hitNo description
PROSITE profilePS5021710.611181244IPR004827Basic-leucine zipper domain
PfamPF001706.7E-9183240IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.45E-11183235No hitNo description
CDDcd147031.44E-23184233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MNKDKAPMPG DGGPSDGLPP QSTRRAGAPP SSSTPPLECD ISRMPDFPTR STGHRRAHSE  60
ILGLPDDLDL SAPGGGEGPS LSDENDEELF SMFLDVDKLN SSCGASSEAE AESSSAAGGG  120
GEGAELADAP RPRHQHSQSM DGSMSIKAEQ LVGAPGMEGM SSAEAKKAVS AAKLAELALV  180
DPKRAKRIWA NRQSAARSKE RKMQYIGELE LKVQTLQTEA TTLSAQLALL QRDTTGLTTE  240
NSELKIRLQT MEQQVHLQDA LNDTLKTEVQ RLKVATGQVG NGGGGMMLNF GAMPRLVGGN  300
QQMFHSSQAM QSVLATHQLQ QLQLHSQPQQ QQLHSLQLQQ VARDLKMKGH LGGQGQWGDG  360
KSGSGSRSSG S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203ARSKERKMQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.957800.0endosperm| glume| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G180847
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G180847_P01
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0374800.0BT037480.1 Zea mays full-length cDNA clone ZM_BFb0171J09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148566.10.0uncharacterized protein LOC100282182
SwissprotQ69IL41e-152RF2A_ORYSJ; Transcription factor RF2a
TrEMBLB4FK420.0B4FK42_MAIZE; BZIP transcription factor
TrEMBLK4JE810.0K4JE81_MAIZE; BZIP-type transcription factor (Fragment)
STRINGGRMZM2G180847_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-72bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]