PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G180190_P01
Common NameLOC103645994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family LFY
Protein Properties Length: 394aa    MW: 42575.4 Da    PI: 9.4543
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G180190_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY534.24.8e-16313821386
            FLO_LFY   1 mdpea.fsas.lfkwd...praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeeld 87 
                        mdp++ fsa+  f+wd   p++aa       ++    ++ap+   +a    + rele+l+ +yGvr +tva+i+elGft+stL++m+++eld
  GRMZM2G180190_P01   1 MDPNDaFSAAhPFRWDlgpPAPAA------PAPPPPPPPAPQLLPHAPLLSAPRELEDLVAGYGVRPSTVARISELGFTASTLLGMTERELD 86 
                        777654876659****54322222......222222233333333444556689************************************** PP

            FLO_LFY  88 dlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaee. 178
                        d+m++l+ +fr+d+l+Ger+G++aa+raer r+++      r      ++ ++lda+sqe+ls+e++     aa+sgg  +gea+  ++++ 
  GRMZM2G180190_P01  87 DMMAALAGLFRWDVLLGERFGLRAALRAERGRVMSLG---GRF-----HTGSTLDAASQEVLSDERD-----AAASGGLAEGEAGRRMVTAg 165
                        **********************************955...555.....36789***********987.....56666666666666665553 PP

            FLO_LFY 179 kkseeekkkaskk.kqkrkkkkelkseededeeeeededeeg........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCre 261
                        kk+ ++   a+k  k++rkk+ +     d++++ +ed  + g        +g++g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr 
  GRMZM2G180190_P01 166 KKKGKKGVGARKGkKARRKKELRPLDVLDDENDGDEDGGGGGsdstessaGGSGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRV 257
                        44444444443431333333333333344444444433332244555555888999************************************ PP

            FLO_LFY 262 fLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgw 353
                        fLlqvq++ak  G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+
  GRMZM2G180190_P01 258 FLLQVQSLAKLGGHKSPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGF 349
                        ******************************************************************************************** PP

            FLO_LFY 354 didavfnahprLsiWYvPtkLrqLChlerskas 386
                        didavf+ahprL+iWYvPt+LrqLCh++r +++
  GRMZM2G180190_P01 350 DIDAVFSAHPRLTIWYVPTRLRQLCHQARGSHA 382
                        *****************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.7E-1901382IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP APAAPAPPPP PPPAPQLLPH APLLSAPREL EDLVAGYGVR  60
PSTVARISEL GFTASTLLGM TERELDDMMA ALAGLFRWDV LLGERFGLRA ALRAERGRVM  120
SLGGRFHTGS TLDAASQEVL SDERDAAASG GLAEGEAGRR MVTAGKKKGK KGVGARKGKK  180
ARRKKELRPL DVLDDENDGD EDGGGGGSDS TESSAGGSGG GERQREHPFV VTEPGEVARA  240
KKNGLDYLFH LYEQCRVFLL QVQSLAKLGG HKSPTKVTNQ VFRYAKKCGA SYINKPKMRH  300
YVHCYALHCL DEEASNALRR AYKARGENVG AWRQACYAPL VEIAARHGFD IDAVFSAHPR  360
LTIWYVPTRL RQLCHQARGS HAHAAAGLPP PPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1002203802162PROTEIN LEAFY
2vy2_A1e-1002203802162PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165184KKKGKKGVGARKGKKARRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.67880.0ear| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G180190
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G180190_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1798820.0AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668956.10.0PREDICTED: probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A096T2V90.0A0A096T2V9_MAIZE; Uncharacterized protein
STRINGGRMZM2G180190_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70181619
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.18e-98floral meristem identity control protein LEAFY (LFY)