PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G179325_P01
Common NameLOC103640045, Zm.93152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 721aa    MW: 79879 Da    PI: 4.8103
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G179325_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.16.5e-1103417121373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av+s+d + a++lL +++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    ++ l+a++l+  +  + +
  GRMZM2G179325_P01 341 LRTLLVHCAQAVASDDRRSATELLRQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AADILQAYQLYMAAICFKR 429
                        6789************************************************************999998...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        + ++  N++I++a+ g+ ++Hi+D++i +G+QWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+k+A+++gvpf++++++
  GRMZM2G179325_P01 430 VVFVFSNNTIYNAALGKMKIHIVDYGIHYGFQWPCFLRWIADREGGPPEVRITGIDLPQPGfrPTQRIEETGRRLSKYAQQFGVPFKYQAIA 521
                        ************************************************************9******************************* PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a+++e+++ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal +ysalfd+l+++
  GRMZM2G179325_P01 522 ASKMESIRAEDLNLDPEEVLIVNCLYQFKNLMDESVVIESPRDIVLNNIRKMRPHTFIHAIVNGSFSAPFFVTRFREALFFYSALFDALDTT 613
                        ******************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         pr+s++r+ +E+ l+gr++ nv+aceg++r+er et+++W+ r ++aG+k+ pl+ ++++ ++  +r  + + + ++ ++++l++gWk+r 
  GRMZM2G179325_P01 614 TPRDSNQRMLIEENLFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQQPLNPDVVQVVRNKVRDLYHKDFVIDIDHHWLLQGWKGRI 705
                        ***********************************************************************888****************** PP

               GRAS 367 LvsvSaW 373
                        L+++S W
  GRMZM2G179325_P01 706 LYAISTW 712
                        ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.41315693IPR005202Transcription factor GRAS
PfamPF035142.3E-107341712IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MGSSYDPYPS PAADDLFLYL SDLGPASPSA YLDLPPTPQP QPYPQSQQQQ QGSKGPTQDM  60
LLPYISSMLM EDDIDDTFFY DYPDNPALLQ AQQSFLDILS DDASSPTTTT GTTNSSASVN  120
HSSSDASASA PLTPAAVDSY SPAPAVQFDG FDLDPAAFFS NGANSDLMSS AFLKGMEEAN  180
KFLPSEDKLV IDLDPPDDPK RFVLPTRAAE NLAPGFNAAA ATTAPAAVAM AVKEEEVILA  240
APDAALGSGG VVLGRGRRNR LDDDEEDLEL QRRSSKQSAL QGDGDERDVF EKYIMTCPET  300
CTEQMQQLRI AMQEEAAKEA AVAAGNGKAK GRRGGREVVD LRTLLVHCAQ AVASDDRRSA  360
TELLRQIKQH ASPQGDATQR LAHCFAEGLQ ARLAGTGSMV YQSLMAKRTS AADILQAYQL  420
YMAAICFKRV VFVFSNNTIY NAALGKMKIH IVDYGIHYGF QWPCFLRWIA DREGGPPEVR  480
ITGIDLPQPG FRPTQRIEET GRRLSKYAQQ FGVPFKYQAI AASKMESIRA EDLNLDPEEV  540
LIVNCLYQFK NLMDESVVIE SPRDIVLNNI RKMRPHTFIH AIVNGSFSAP FFVTRFREAL  600
FFYSALFDAL DTTTPRDSNQ RMLIEENLFG RAALNVIACE GTDRVERPET YKQWQVRNQR  660
AGLKQQPLNP DVVQVVRNKV RDLYHKDFVI DIDHHWLLQG WKGRILYAIS TWVANDAPSY  720
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-393457128374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.43910.0ear| endosperm| meristem| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G179325
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G179325_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277580.0KJ727758.1 Zea mays clone pUT5702 GRAS transcription factor (GRAS50) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008660921.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A096T2C20.0A0A096T2C2_MAIZE; Uncharacterized protein
STRINGGRMZM2G179325_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-155GRAS family protein