PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G176063_P01
Common NameLOC103650524, Zm.21747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 341aa    MW: 35046.1 Da    PI: 8.7446
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G176063_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.6e-38109166562
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +l+cprCds+ntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  GRMZM2G176063_P01 109 TLRCPRCDSANTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 166
                        679***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3191164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.273110164IPR003851Zinc finger, Dof-type
PfamPF027011.5E-31110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MVFSSLPIFL DPPNWGQMHM QQQQPLQCLL DGGAGSDHHH LMPPPSCLAP LRGGPADTAA  60
SAPAGGGSST SVPTTAGAGA GAGATQPRPV VSMAERARLV RVPLPEPGTL RCPRCDSANT  120
KFCYFNNYSL SQPRHFCKAC RRYWTRGGAL RNVPVGGGCR RNTKRSSKKS SRGGGAGATA  180
ATSSSSTTST STTATTTTTS AAMAAAEAIA SMQAQLPHLG LPPAAAAAAL EASLEGYHHH  240
YLPLQMQPQF LQQAGLHGYH FADDGSGVLA DGFPRGVVAS GLLAQLAAVK MEEHSSNGGG  300
AVTAHQQEQS YSYWPGSTGG GSGWPAEFLS GFSSSSSGNV L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.217470.0ear| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G176063
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G176063_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824190.0KC582419.1 Sorghum bicolor dof28 protein (dof28) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001333768.10.0uncharacterized protein LOC103650524
TrEMBLA0A1D6MWU50.0A0A1D6MWU5_MAIZE; Dof zinc finger protein DOF2.2
STRINGGRMZM2G176063_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-38Dof family protein