PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G175870_P02
Common NameLOC100274522
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 229aa    MW: 24839.8 Da    PI: 5.3457
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G175870_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44e-1077122651
                        HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                        + rr   NReA r++R++Kka  + Lee+vk+L a N++L+ +l+ 
  GRMZM2G175870_P02  77 KPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLQRRLQG 122
                        5688889**********************************99874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.1E-1670140No hitNo description
SMARTSM003386.0E-971139IPR004827Basic-leucine zipper domain
PfamPF077161.0E-1374128IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.08274121IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.2E-878122No hitNo description
CDDcd146861.94E-1279131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDDGADLPCQ LLFSHPEMPD SFDEFFNSAT TTCTHTHSCN PPGPSVAMHT HTCLHAHTLV  60
LGSGGEDDDD AREDSAKPRR PLGNREAVRK YREKKKAHAA FLEEEVKKLR AANQQLQRRL  120
QGHAALEAEV ARLRGLLLDI RGKIDAEVGG VLPFQKPCSV GSVACADPAL CFNGNSEVGG  180
GWEESSRPAA ADCRIDEVRG MSREIDVPEG LRHSMDVVAS FVSSDPLAE
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G175870
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G175870_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0432560.0BT043256.1 Zea mays full-length cDNA clone ZM_BFc0133G19 mRNA, complete cds.
GenBankBT0605320.0BT060532.1 Zea mays full-length cDNA clone ZM_BFb0012N22 mRNA, complete cds.
GenBankBT0879560.0BT087956.1 Zea mays full-length cDNA clone ZM_BFb0329N19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.11e-169uncharacterized protein LOC100274522
RefseqXP_020394445.11e-169putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394446.11e-169putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394447.11e-169putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394448.11e-169putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394449.11e-169putative bZIP transcription factor superfamily protein isoform X1
SwissprotQ8GTS21e-49BZP23_ARATH; Basic leucine zipper 23
TrEMBLB4G1L81e-168B4G1L8_MAIZE; Basic leucine zipper 24
STRINGGRMZM2G175870_P011e-169(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-32bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]