PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G175827_P02
Common Namekan3, ZEAMMB73_077734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family G2-like
Protein Properties Length: 468aa    MW: 49074.3 Da    PI: 9.1538
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G175827_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.2e-32258311255
            G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GRMZM2G175827_P02 258 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 311
                        9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15255312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28256312IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23258311IPR006447Myb domain, plants
PfamPF002497.1E-7259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MEARAVSALD LSLHISLPSS AAGSASPAPE LGGGGGIGRG AQPPAGADPW RRLNGSTAST  60
ELSLSPPLWQ QDVAAGDVLP CRRLRPAAPN HYSSTADATT FVPVTVPRLI SFDAAAGAED  120
EAARARPIEG VPVYSSSRAA RRPFLGAGAG EYHRQGHHPK AAGLYNRPCH SSSRPSSLRS  180
TTTTTSPAVA PPAESSYLSP SAYHRMLSST SRLRLQGVLA DTLRGYGGHH HQQQHLDSLA  240
AARYMPRFLA SRRGMRAPRM RWTSSLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA  300
HVKSHLQMYR TVKSTDKPAT TSSGGPPVDG GGDDDDLPSA RRAQSSSSSP AGRRDGSSPQ  360
AFTRHRSAAS SEGAASLAGG DDVECSSSAD DSDCGRARSA SSSRDQLLPP SAGSAGTLPS  420
VGVSSSTTED MEPAYRSVGL QQAPNHEMSC PPSLEFRLGR PIWNGAEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-16259313357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G175827
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and flowers. {ECO:0000269|PubMed:18594992}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G175827_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0424080.0BT042408.1 Zea mays full-length cDNA clone ZM_BFb0221N18 mRNA, complete cds.
GenBankEU9253990.0EU925399.1 Zea mays KANADI3 (kan3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307939.10.0uncharacterized protein LOC100279550
SwissprotQ0J2352e-69ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLB4FZ700.0B4FZ70_MAIZE; KANADI3
TrEMBLK0DF870.0K0DF87_MAIZE; GLK46 G2-like transcription factor (Fragment)
STRINGGRMZM2G175827_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-40G2-like family protein
Publications ? help Back to Top
  1. Candela H,Johnston R,Gerhold A,Foster T,Hake S
    The milkweed pod1 gene encodes a KANADI protein that is required for abaxial/adaxial patterning in maize leaves.
    Plant Cell, 2008. 20(8): p. 2073-87
    [PMID:18757553]