PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G171852_P01
Common NameDOF22, LOC100275168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 359aa    MW: 36207.1 Da    PI: 8.6626
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G171852_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3960121263
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                        kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  GRMZM2G171852_P01  60 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 121
                        7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2754109IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3362118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05964118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEEMLMAGNA NLNQNPNPPP AAPSAPGAQR AGAPAAVAAA PPSAGATGGA GPERRARPQK  60
EKALNCPRCN STNTKFCYYN NYSLQQPRYF CKTCRRYWTE GGSLRNVPVG GGSRKNKRSS  120
SAVSSAAAAA AASTSAAMSG TVPVGLAAKN PKLMHEGAHD LNLAFPHHNG RALQPPEFPA  180
FPSLESSSVC NPGAAMLGNG AAGRGMGALS GLELLRSTGC YVPLQHFQLG MPAEYAAAGF  240
SLGEFRVPPP PQSQSVFGFS LDTHGTGGVG GAGGYSAGLQ ESAAGRMLFP FEDLKPAVSA  300
AGGGASNGAD HHHYEHSKDQ AAGDGGGASG VTGGHEAPAG FWSNSMIGNG SSNGGGGSW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1246640.0sheath
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G171852
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in germinating seeds 3 to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G171852_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269960.0KJ726996.1 Zea mays clone pUT3968 C2C2-DOF transcription factor (DOF22) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142794.10.0uncharacterized protein LOC100275168
RefseqXP_008681604.10.0uncharacterized protein LOC100275168 isoform X3
RefseqXP_020408786.10.0uncharacterized protein LOC100275168 isoform X1
SwissprotB9F1L81e-119DOF2_ORYSJ; Dof zinc finger protein 2
TrEMBLB6SPI70.0B6SPI7_MAIZE; C2C2-DOF transcription factor
STRINGGRMZM2G171852_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-36Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]