PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G171370_P05
Common NameZm.75910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 110aa    MW: 12258.9 Da    PI: 7.0284
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G171370_P05genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.32.9e-1216552463
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1 24 KkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                       +++e+eeL++kv+ L++eN+aL+ el++l+k ++ +++e+
  GRMZM2G171370_P05 16 FQQECEELARKVADLTTENSALRAELDNLRKACQDMEAEN 55
                       69**********************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF902579.15E-51759No hitNo description
PfamPF001701.2E-81755IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.4E-71752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MLMIMKKCSH LLCLIFQQEC EELARKVADL TTENSALRAE LDNLRKACQD MEAENSRLLV  60
STVPSVTTTL GMSIEPPKAQ QHHDDEGQLH KKSSNNSNGK GSHKPEANTR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.759101e-158ear| embryo| meristem| ovary| pericarp| pollen| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G171370
Functional Description ? help Back to Top
Source Description
UniProtInteracts specifically with the 8-bp sequence 5'-CACGTGGC-3'in the abscisic acid response element (ABARE). Also binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G171370_P05
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9704860.0EU970486.1 Zea mays clone 346423 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668105.12e-62DNA-binding protein EMBP-1 isoform X2
SwissprotP250323e-13EMBP1_WHEAT; DNA-binding protein EMBP-1
TrEMBLA0A1D6ELA44e-61A0A1D6ELA4_MAIZE; G-box-binding factor 1
TrEMBLA0A1D6ELA61e-61A0A1D6ELA6_MAIZE; G-box-binding factor 1
TrEMBLB8A3T44e-62B8A3T4_MAIZE; BZIP transcription factor
STRINGGRMZM2G171370_P037e-62(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35530.11e-06basic region/leucine zipper transcription factor 16