PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G170958_P01
Common NameLOC100280846, ZEAMMB73_875188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 294aa    MW: 31374.1 Da    PI: 8.1858
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G170958_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.51.5e-153595257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  GRMZM2G170958_P01 35 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 95
                       89*****************99*************************************997 PP

2Wus_type_Homeobox104.66.4e-343496264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
  GRMZM2G170958_P01 34 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 96
                       689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.4993196IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-831102IPR009057Homeodomain-like
SMARTSM003892.2E-533100IPR001356Homeobox domain
SuperFamilySSF466892.14E-1233101IPR009057Homeodomain-like
PfamPF000462.6E-133595IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0020136anatomyear inflorescence
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGSHSHLGQA LQAHHHHHHH HRGGECEPAT AAAARSRWAP KPEQILILES IFNSGMVNPA  60
KDETARIRRL LERFGAVRDA NVFYWFQNRR SRSRRRARQL QQQQAGSGPQ HPTAAAAAGH  120
VHGANANDGV SLYAMHGHAG QQQQARAAGL PAVAPVVLPP AAVASSPRFF GDEIDTDGGD  180
DLFAISRQMG LMSRGGEQHG CGYVANNDAS QSHLLSYQPT GTATTAAAAY IQVSINGVVY  240
EVPGAGALLD LAGTFGRDAM LVHSSGEILP VNENGVLMKS LQMGECYYLV SKST
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G170958
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G170958_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9541720.0EU954172.1 Zea mays clone 1457989 WUSCHEL-related homeobox 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147238.10.0WUSCHEL-related homeobox 11
SwissprotA2YST13e-86WOX10_ORYSI; WUSCHEL-related homeobox 10
TrEMBLK7U0180.0K7U018_MAIZE; Putative homeobox DNA-binding domain superfamily protein
STRINGGRMZM2G170958_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP46971222
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.22e-28WUSCHEL related homeobox 12