PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G170079_P02
Common NameZEAMMB73_256741, Zm.146111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 210aa    MW: 21752.8 Da    PI: 5.3205
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G170079_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.78.8e-12154198448
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  GRMZM2G170079_P02 154 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQNEVSVLSPR 198
                        5999*********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-8151210IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.048153210IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-14155207No hitNo description
PfamPF001702.8E-10155200IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.36E-12155209No hitNo description
CDDcd147031.73E-26156207No hitNo description
PROSITE patternPS000360158173IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MAQQLPPRIP TEVHHWPEGG QHGAAAAWAD DFAEFAAARR GAHRRSLSDS VAFVEVAPAD  60
GGAGEFDRLD DDQLLSMFPP DEAGGGGSSA AGSENGGSSD SDGDKRGARG GPAGGAPSTG  120
SGGGEQNGVV DAQAPAATGG QAAVVASTEL IRDPKRVKRI LANRQSAQRS RVRKLQYISE  180
LERSVTTLQN EVSVLSPRVA FLDQQRTILS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.752811e-111sheath| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G170079
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots and panicles. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G170079_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699270.0JX469927.1 Zea mays subsp. mays clone UT3185 bZIP-type transcription factor mRNA, partial cds.
GenBankKJ7267850.0KJ726785.1 Zea mays clone pUT1861 bZIP transcription factor (bZIP20) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008657219.11e-147basic leucine zipper 6
SwissprotQ5JMK69e-68BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLA0A1D6GBD71e-146A0A1D6GBD7_MAIZE; BZIP-type transcription factor
STRINGGRMZM2G170079_P021e-147(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-28bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]