PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G170079_P01
Common NamebZIP20, ZEAMMB73_256741, Zm.146111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 205aa    MW: 21287.5 Da    PI: 6.3611
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G170079_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1315.4e-10154189439
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L+
  GRMZM2G170079_P01 154 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQ 189
                        5999****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0022151205IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.85E-9155193No hitNo description
PfamPF001702.0E-8155189IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-10155190No hitNo description
CDDcd147035.47E-19156189No hitNo description
PROSITE patternPS000360158173IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAQQLPPRIP TEVHHWPEGG QHGAAAAWAD DFAEFAAARR GAHRRSLSDS VAFVEVAPAD  60
GGAGEFDRLD DDQLLSMFPP DEAGGGGSSA AGSENGGSSD SDGDKRGARG GPAGGAPSTG  120
SGGGEQNGVV DAQAPAATGG QAAVVASTEL IRDPKRVKRI LANRQSAQRS RVRKLQYISE  180
LERSVTTLQV RIHAQLLYII SIVRI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.752817e-77sheath| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G170079
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots and panicles. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G170079_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699270.0JX469927.1 Zea mays subsp. mays clone UT3185 bZIP-type transcription factor mRNA, partial cds.
GenBankKJ7267850.0KJ726785.1 Zea mays clone pUT1861 bZIP transcription factor (bZIP20) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008657219.11e-131basic leucine zipper 6
SwissprotQ5JMK66e-52BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLK4JBR31e-143K4JBR3_MAIZE; BZIP-type transcription factor (Fragment)
TrEMBLK7W4J91e-143K7W4J9_MAIZE; BZIP transcription factor (Fragment)
STRINGGRMZM2G170079_P021e-131(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-17bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]