PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G169580_P01
Common Namesi614035g09a
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Trihelix
Protein Properties Length: 672aa    MW: 72812.6 Da    PI: 6.1911
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G169580_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.97.9e-30100184187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+++e+laLi++r+em+ ++r++ lk+plWe+v++k++  g++rs+k+Ckek+en++k+yk++k+   +r++++s  +++f+qlea
  GRMZM2G169580_P01 100 RWPREETLALIRIRTEMDADFRNAPLKAPLWEDVARKLAGLGYHRSAKKCKEKFENVHKYYKRTKDAHAGRQDGKS--YRFFSQLEA 184
                        8*********************************************************************866665..*******85 PP

2trihelix108.54.4e-34413498187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k+ev aLi++r+e++e++ ++  k+plWe++++ mr+ g++rs+k+Ckekwen+nk+ykk+ke++k+r +e+s+tcpyf+ql+a
  GRMZM2G169580_P01 413 RWPKEEVEALIQVRNEKDEQYHDAGGKGPLWEDIAAGMRRIGYNRSAKRCKEKWENINKYYKKVKESNKRR-PEDSKTCPYFHQLDA 498
                        8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.8E-497159IPR001005SANT/Myb domain
CDDcd122038.29E-2899164No hitNo description
PfamPF138371.0E-2099185No hitNo description
PROSITE profilePS500907.15599157IPR017877Myb-like domain
SMARTSM007176.6E-6410472IPR001005SANT/Myb domain
PfamPF138377.3E-23412499No hitNo description
PROSITE profilePS500907.875412470IPR017877Myb-like domain
SuperFamilySSF466892.85E-5412482IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-4412469IPR009057Homeodomain-like
CDDcd122033.69E-26413477No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006340anatomyadult vascular leaf
PO:0009025anatomyvascular leaf
PO:0020127anatomyprimary root
PO:0001052developmental stagevascular leaf expansion stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MLHHHGGAGS PYMAPTTADT GMDPFSPTPA TRPAVSVTAI PPPPTMQLRP AGAGPSADFE  60
ELPAGGAGAG AAASLQDDDM QMQADYGASA AGASGSGGNR WPREETLALI RIRTEMDADF  120
RNAPLKAPLW EDVARKLAGL GYHRSAKKCK EKFENVHKYY KRTKDAHAGR QDGKSYRFFS  180
QLEALHAAAP QPQPPSGMTT VQAGPHHPMA LAWTAGPTAL GPAAGAGLPD LSFSSMSGSE  240
SEYDSDDDDD DDAGEEGLGR GEYHREMMAI FEGMMKQVTD KQDAMQRVFL ETLERWEAER  300
TAREEAWRRQ EVARMNRERE RLARERAAAA SRDAALIAFL QCVGGGQGQP VRLPPHSAGA  360
SVVPAPPKPD CAPPSPRLDA AATSLQQLVP AQLKAVEALA WAGGEGGGST SSRWPKEEVE  420
ALIQVRNEKD EQYHDAGGKG PLWEDIAAGM RRIGYNRSAK RCKEKWENIN KYYKKVKESN  480
KRRPEDSKTC PYFHQLDAMY RKKHRGDRGR ITAAGPNMQD SPSQRELEGK SSNDVDIDNR  540
KSDEQGNVHT SPVSGNRDTA PTTTRPPGDG AKNKTAEDNL KRTNVQLKQQ QHEFGTDETD  600
SDDDMARNHT AYTEEDDDEA KIKYKMDFQN PNMIGSSSNM SAPPPPAAAA ATTAAAPTTS  660
AAPTSNTFLA VQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.320070.0ovary| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G169580
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G169580_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0548720.0BT054872.1 Zea mays full-length cDNA clone ZM_BFc0165O02 mRNA, complete cds.
GenBankBT0677670.0BT067767.1 Zea mays full-length cDNA clone ZM_BFc0150E20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146214.10.0uncharacterized LOC100279784
RefseqXP_008643481.10.0uncharacterized protein LOC100279784 isoform X1
TrEMBLB7ZZY00.0B7ZZY0_MAIZE; GT-2-like 1
STRINGGRMZM2G169580_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-43Trihelix family protein