PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G168079_P01
Common NameZEAMMB73_125662, Zm.18160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 412aa    MW: 43446.9 Da    PI: 6.2769
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G168079_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.19.5e-14328372549
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                        +r+rr++kNRe+A rsR+RK+a++ eLe +   L++eN++L+ e 
  GRMZM2G168079_P01 328 RRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENERLRAEE 372
                        79****************************************874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-13324390IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.243326371IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10328373No hitNo description
PfamPF001702.5E-11328374IPR004827Basic-leucine zipper domain
CDDcd147071.02E-22328369No hitNo description
Gene3DG3DSA:1.20.5.1704.9E-13328372No hitNo description
PROSITE patternPS000360331346IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MASEMSKNVK ALDEQEVTSQ HSRAQTSDAA EEQQQQQQAV DPLARQSSIM SLTLEELQNS  60
LCEPGRNFGS MNMDEFMANI WNAEEFQAAT AGCNKEGAER EPVPVATTTG TGENGGGGGS  120
GRGLVRQGSF ALPPPLSRKT VEEVWAEISQ GPADFQASAA PQPVAQPQAA SGGGVAASGR  180
QATLGEMTLE DFLVKAGVVR GAFAGHGHGV GMVPAGPMGM QHNAAPPMMY QVAAAAAPPP  240
GAVYPVMGDG MGYHGGGYPG GVAVVPPPPP SQCVAAAASP GSSDGMSAMT QAEMMNCIGN  300
GGVVRNGGGG ARKRDFPEDG CTEKTVERRQ RRMIKNRESA ARSRARKQAY TVELEAELNH  360
LKEENERLRA EERTILLSKK KMLVEKMMEQ ARENVSAKKV GPGLRRWGSA MW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.181600.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G168079
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves and panicles (PubMed:17604002). Expressed in seeds (PubMed:21055780). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:21055780}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G168079_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9710270.0EU971027.1 Zea mays clone 356068 ABA response element binding factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151515.10.0ABA response element binding factor
SwissprotQ8RZ351e-162ABI5_ORYSJ; bZIP transcription factor ABI5 homolog
TrEMBLB6UI010.0B6UI01_MAIZE; ABA response element binding factor
STRINGGRMZM2G168079_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.23e-28abscisic acid responsive element-binding factor 1
Publications ? help Back to Top
  1. Zou M,Guan Y,Ren H,Zhang F,Chen F
    A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.
    Plant Mol. Biol., 2008. 66(6): p. 675-83
    [PMID:18236009]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  3. Kim H, et al.
    A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.
    J. Exp. Bot., 2012. 63(2): p. 1013-24
    [PMID:22071266]
  4. Bhatnagar N, et al.
    The protein phosphatase 2C clade A protein OsPP2C51 positively regulates seed germination by directly inactivating OsbZIP10.
    Plant Mol. Biol., 2017. 93(4-5): p. 389-401
    [PMID:28000033]