PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G167824_P01
Common Nameyab10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 320aa    MW: 33396 Da    PI: 8.7606
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G167824_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY81.13.4e-254593553
              YABBY  5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlaka 53
                        +seq+Cyv+C fC+t+l+vsvP++slfk+vtvrCGhC+sll+vn++  
  GRMZM2G167824_P01 45 PASEQLCYVHCHFCDTVLVVSVPTSSLFKTVTVRCGHCSSLLTVNMRGL 93
                       689*****************************************99865 PP

2YABBY131.51.1e-40212278105170
              YABBY 105 edeevprvpp.virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                         +e +pr+   ++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  GRMZM2G167824_P01 212 AKEPSPRANSaINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 278
                        566778887769*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.8E-6146278IPR006780YABBY protein
SuperFamilySSF470957.59E-8217271IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.9E-4227270IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSSSSSSSSA ATVFPPSPQL PPPLLVENLP PLHQLTPPVA AAAAPASEQL CYVHCHFCDT  60
VLVVSVPTSS LFKTVTVRCG HCSSLLTVNM RGLLFPGTPA NTAAAAAAAP PPPPAAAVTS  120
TTATMTTAPP PPPATSVNNN GQFHFIPHSL DLALPIPPHQ SLLLDEISSA ANPSLQLLEQ  180
HGLGGMITSG RNAAAPHPHP PQPQAPAAGK GAKEPSPRAN SAINRPPEKR QRVPSAYNRF  240
IKDEIQRIKA GNPDISHREA FSAAAKNWAH FPHIHFGLMP DHQGPKKTSL LPQDHQRSDG  300
GGLLKEGLYA AAANMGVAPY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.40410.0ear| embryo| endosperm| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G167824
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G167824_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3139040.0AY313904.1 Zea mays yabby10 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105723.10.0yabby homolog10
SwissprotQ8L5561e-101YAB3_ORYSJ; Protein YABBY 3
TrEMBLQ7X9M60.0Q7X9M6_MAIZE; Uncharacterized protein
STRINGGRMZM2G167824_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1300345
MonocotsOGMP144538121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.12e-46YABBY family protein
Publications ? help Back to Top
  1. Juarez MT,Twigg RW,Timmermans MC
    Specification of adaxial cell fate during maize leaf development.
    Development, 2004. 131(18): p. 4533-44
    [PMID:15342478]