PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G167560_P01
Common NameCOL14, LOC100193195, LOC103654041, ZEAMMB73_397515, ZEAMMB73_538267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 406aa    MW: 44509.9 Da    PI: 5.1901
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G167560_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.16.6e-07345440
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                       + C  +++++  ++C+++   lC +C  + H+       H+++
  GRMZM2G167560_P01  3 PLCGFCGKQRSMIYCRSDAASLCLSCDRSVHSAnalsrrHRRT 45
                       68*****************************657777778765 PP

2zf-B_box25.52.8e-084788540
           zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        C++++ ++++  C ++++ lC++C  ++H        H+++
  GRMZM2G167560_P01 47 LCDRCGLQPASVRCLEDNTSLCQNCDWNGHDAasgasgHKRQ 88
                       7*****************************447778888876 PP

3CCT63.37.4e-22349392144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        R+ al+RYkeK+k+R F+KkirY+sRKa+A+ R+RvKGrF k+ 
  GRMZM2G167560_P01 349 RDSALTRYKEKKKKRMFDKKIRYASRKARADVRKRVKGRFIKAG 392
                        899*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.94147IPR000315B-box-type zinc finger
SMARTSM003369.0E-11147IPR000315B-box-type zinc finger
CDDcd000213.86E-6347No hitNo description
PROSITE profilePS501199.5564390IPR000315B-box-type zinc finger
PfamPF006439.9E-64688IPR000315B-box-type zinc finger
CDDcd000219.04E-74790No hitNo description
SMARTSM003360.0274890IPR000315B-box-type zinc finger
PfamPF062032.8E-17349391IPR010402CCT domain
PROSITE profilePS5101715.219349391IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0004006anatomymesophyll cell
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MVPLCGFCGK QRSMIYCRSD AASLCLSCDR SVHSANALSR RHRRTLLCDR CGLQPASVRC  60
LEDNTSLCQN CDWNGHDAAS GASGHKRQAI NCYSGCPSSA ELSRIWSFII DIPTVAAEPN  120
CEDGLSMMTI DDSDVTNHHG ASDDKRLLEI ANTALMSDPP SPDKLKPLIG SSSGDGFDVL  180
PLATDQPAGP VSATPKVPYA RDDNKFNDGM YEDLCVDDAD LTFENYEELF GTSHIRIEEL  240
FDDAGIDSYF EMKETPPFDF NEQPKIVQLQ CSDVVPADCA MSNTGERADS SLCIPVRQVR  300
SSISHPLSGL TGESSAGDHQ DCGVSPILLM GEPPWYSPGP EGSLAGGSRD SALTRYKEKK  360
KKRMFDKKIR YASRKARADV RKRVKGRFIK AGEAYDYDPL SQTRSY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.182500.0aerial organ| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G167560
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G167560_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353980.0BT035398.1 Zea mays full-length cDNA clone ZM_BFb0059C10 mRNA, complete cds.
GenBankEU9722430.0EU972243.1 Zea mays clone 378354 zinc finger protein CONSTANS-LIKE 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001131822.10.0uncharacterized protein LOC100193195
RefseqXP_008676530.10.0uncharacterized protein LOC100193195 isoform X1
RefseqXP_023157920.10.0uncharacterized protein LOC100193195 isoform X1
SwissprotQ9SSE51e-121COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLB4FE600.0B4FE60_MAIZE; C2C2-CO-like transcription factor
STRINGGRMZM2G042198_P010.0(Zea mays)
STRINGGRMZM2G167560_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-101CONSTANS-like 9
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]