PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G166946_P02
Common NameLOC100284941, TCP30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 283aa    MW: 30475.1 Da    PI: 9.343
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G166946_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.73.7e-2949116370
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                        g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++
  GRMZM2G166946_P02  49 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQ 116
                        78*************************************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.5E-2750111IPR005333Transcription factor, TCP
PROSITE profilePS5136929.95150108IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0025142anatomyleaf tip
PO:0025541anatomybundle sheath cell
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MIRGGNHQQA ADVEEELARN SRHAAAVATS RQWSAQTESR IVRVSRVFGG KDRHSKVKTV  60
KGLRDRRVRL SVPTAIQLYD LQDRLGLNQP SKVVDWLLNA ARHEIDKLPP LQFPPQDLMV  120
GHLTPHNMPL MVHDEKFGHL AAAAALASGG GGGAKVSQQG NVVDVDGTGA HHLVGRFPGG  180
YHRFMELNSA LGMVSGAMAP PYNNNYTGEA WNNSGGGVHD SGSPQIVAAA AHHSPFPSLL  240
SLAPRPHQLA FYSSEADQQF QVENLGSQSL SLSSARAYHD QAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2055109155Putative transcription factor PCF6
5zkt_B2e-2055109155Putative transcription factor PCF6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.324510.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G166946
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G166946_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702170.0EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151308.10.0uncharacterized protein LOC100284941
RefseqXP_008672990.10.0TCP family transcription factor containing protein isoform X1
RefseqXP_008672991.10.0TCP family transcription factor containing protein isoform X1
TrEMBLA0A3L6FKJ70.0A0A3L6FKJ7_MAIZE; Transcription factor TCP5
TrEMBLB6TZ020.0B6TZ02_MAIZE; TCP family transcription factor containing protein
STRINGGRMZM2G166946_P030.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.13e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]